Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6429
Gene name
LocationContig_33:47677..49263
Strand+
Gene length (bp)1586
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 1.7E-22 66 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 62 501 3.0E-45
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 14 501 4.0E-34
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 37 306 1.0E-16
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 59 253 2.0E-16
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 59 233 2.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 62 501 3.0E-45
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 14 501 4.0E-34
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 37 306 1.0E-16
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 59 253 2.0E-16
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 59 233 2.0E-12
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 34 256 4.0E-12
sp|D4B1Z7|A2478_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02478 PE=1 SV=1 131 234 6.0E-12
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 22 347 1.0E-09
sp|O22213|CKX1_ARATH Cytokinin dehydrogenase 1 OS=Arabidopsis thaliana GN=CKX1 PE=1 SV=1 66 238 4.0E-09
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 76 491 5.0E-08
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 66 224 1.0E-07
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 22 347 2.0E-07
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 38 222 2.0E-07
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 65 290 4.0E-07
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 22 290 9.0E-07
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 22 290 1.0E-06
sp|Q90YK3|GGLO_SCYTO L-gulonolactone oxidase OS=Scyliorhinus torazame GN=GULO PE=2 SV=1 47 260 2.0E-06
sp|Q75K78|CKX9_ORYSJ Cytokinin dehydrogenase 9 OS=Oryza sativa subsp. japonica GN=CKX9 PE=2 SV=1 93 238 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0003824 catalytic activity No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:1901363 heterocyclic compound binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6429
MGPSPSKLALKAIAAACLASAAAADPDRDPCRALARALPGEVHLPDSAAYRAENMYWSNRQAEARPRCFVTPRGT
MEVSRALKTLTELRAPFSVKSGGHTAFEGGSGADKGVTIDLVNFREVTVWSDNKTVTVGAGNRWINVSRALDPLG
LAVVGGRAADVGVSGLILGGGISYFSGTRGWACDNVRSFRVVVSSGDAVTASPTENQDLYWALRGGGGSSFGIVV
SFDLEAFPQADLWTNSIIFPGASNKTLIPLFTHLSNRGLVENPQAHAYFVLSYQPGISGFAVLTSFFQSTPLPNH
AVPSVFQPFQSVPGAVSNVAQVVNISTQSMAIDQPSGSRQTWWDTSVSMASPKLFEDIVSMYEDYVHKLLEAAKG
SKLTTFLVFQPISQNVVDAMQKNGGNALGLKPSDGPLMIVQISVQWSDKNLDSVVEGSSQSLIEDVETLSKARGL
FRGFIYMNYAGKSQDVFGRYGRESYDRLKKTAFRWDPNGLLEDLWKGYFQVRNFEHD*
Coding >Hirsu2|6429
ATGGGGCCCTCCCCGTCCAAGCTGGCTCTCAAGGCCATCGCCGCGGCCTGCTTGGCCTCGGCCGCGGCCGCCGAC
CCGGACAGGGACCCATGCCGTGCCTTGGCCAGGGCTCTGCCCGGGGAGGTCCACCTCCCGGACTCGGCCGCGTAC
CGGGCCGAGAACATGTACTGGTCCAACCGGCAGGCCGAGGCCCGTCCGCGATGCTTCGTGACGCCCAGGGGCACC
ATGGAGGTCTCCCGGGCCCTGAAGACGCTGACGGAGCTGCGGGCGCCCTTCAGCGTCAAGTCCGGCGGACACACG
GCGTTCGAGGGGGGGTCCGGCGCCGATAAAGGCGTCACCATCGACCTCGTGAATTTCCGCGAGGTCACCGTATGG
TCCGACAACAAGACCGTCACGGTCGGCGCCGGCAACCGATGGATCAACGTCTCGCGCGCGCTCGACCCCCTGGGC
CTGGCCGTCGTGGGCGGACGGGCCGCCGACGTCGGCGTCAGCGGCCTGATCCTCGGTGGCGGCATCTCCTATTTC
TCGGGCACGCGCGGCTGGGCGTGCGACAACGTCCGCTCGTTCCGCGTCGTCGTCTCTTCGGGGGACGCGGTCACG
GCGTCGCCCACCGAAAATCAGGATCTGTACTGGGCCCTCCGCGGCGGCGGCGGCTCCAGCTTCGGCATCGTCGTC
TCCTTCGACCTCGAGGCCTTCCCGCAAGCCGACCTGTGGACAAACTCGATCATCTTCCCCGGGGCCTCGAACAAG
ACCTTGATCCCCCTGTTTACCCATCTCAGCAACCGGGGCCTGGTGGAGAACCCCCAGGCTCACGCCTACTTCGTC
CTGAGCTACCAACCTGGCATCAGCGGCTTCGCCGTTCTGACCAGCTTCTTCCAGTCGACGCCACTGCCGAACCAC
GCCGTACCGTCCGTCTTCCAGCCGTTTCAGTCCGTCCCTGGAGCCGTTTCCAACGTAGCGCAGGTGGTCAACATC
TCGACCCAGTCCATGGCCATTGACCAGCCTTCGGGCTCTCGCCAGACCTGGTGGGACACGTCTGTCTCCATGGCC
TCGCCCAAGCTTTTCGAAGACATTGTCTCCATGTACGAGGACTATGTGCACAAGCTGCTCGAAGCCGCCAAGGGC
TCCAAGTTGACTACCTTTCTCGTTTTCCAGCCCATCTCCCAGAACGTCGTCGATGCCATGCAGAAGAATGGCGGA
AACGCGCTGGGCCTCAAGCCCAGCGATGGGCCACTGATGATTGTGCAGATTTCAGTCCAGTGGAGCGACAAAAAC
TTGGATTCCGTCGTCGAAGGCTCATCCCAGTCCTTGATCGAAGACGTCGAGACGCTTTCGAAGGCGAGAGGCCTG
TTCCGAGGATTCATCTACATGAACTATGCCGGGAAAAGCCAAGACGTCTTCGGCCGATACGGTCGAGAGAGCTAC
GATCGTTTAAAAAAGACGGCATTCCGTTGGGACCCCAATGGACTTCTCGAAGATCTCTGGAAGGGGTATTTTCAA
GTCCGCAACTTTGAGCATGACTAG
Transcript >Hirsu2|6429
ATGGGGCCCTCCCCGTCCAAGCTGGCTCTCAAGGCCATCGCCGCGGCCTGCTTGGCCTCGGCCGCGGCCGCCGAC
CCGGACAGGGACCCATGCCGTGCCTTGGCCAGGGCTCTGCCCGGGGAGGTCCACCTCCCGGACTCGGCCGCGTAC
CGGGCCGAGAACATGTACTGGTCCAACCGGCAGGCCGAGGCCCGTCCGCGATGCTTCGTGACGCCCAGGGGCACC
ATGGAGGTCTCCCGGGCCCTGAAGACGCTGACGGAGCTGCGGGCGCCCTTCAGCGTCAAGTCCGGCGGACACACG
GCGTTCGAGGGGGGGTCCGGCGCCGATAAAGGCGTCACCATCGACCTCGTGAATTTCCGCGAGGTCACCGTATGG
TCCGACAACAAGACCGTCACGGTCGGCGCCGGCAACCGATGGATCAACGTCTCGCGCGCGCTCGACCCCCTGGGC
CTGGCCGTCGTGGGCGGACGGGCCGCCGACGTCGGCGTCAGCGGCCTGATCCTCGGTGGCGGCATCTCCTATTTC
TCGGGCACGCGCGGCTGGGCGTGCGACAACGTCCGCTCGTTCCGCGTCGTCGTCTCTTCGGGGGACGCGGTCACG
GCGTCGCCCACCGAAAATCAGGATCTGTACTGGGCCCTCCGCGGCGGCGGCGGCTCCAGCTTCGGCATCGTCGTC
TCCTTCGACCTCGAGGCCTTCCCGCAAGCCGACCTGTGGACAAACTCGATCATCTTCCCCGGGGCCTCGAACAAG
ACCTTGATCCCCCTGTTTACCCATCTCAGCAACCGGGGCCTGGTGGAGAACCCCCAGGCTCACGCCTACTTCGTC
CTGAGCTACCAACCTGGCATCAGCGGCTTCGCCGTTCTGACCAGCTTCTTCCAGTCGACGCCACTGCCGAACCAC
GCCGTACCGTCCGTCTTCCAGCCGTTTCAGTCCGTCCCTGGAGCCGTTTCCAACGTAGCGCAGGTGGTCAACATC
TCGACCCAGTCCATGGCCATTGACCAGCCTTCGGGCTCTCGCCAGACCTGGTGGGACACGTCTGTCTCCATGGCC
TCGCCCAAGCTTTTCGAAGACATTGTCTCCATGTACGAGGACTATGTGCACAAGCTGCTCGAAGCCGCCAAGGGC
TCCAAGTTGACTACCTTTCTCGTTTTCCAGCCCATCTCCCAGAACGTCGTCGATGCCATGCAGAAGAATGGCGGA
AACGCGCTGGGCCTCAAGCCCAGCGATGGGCCACTGATGATTGTGCAGATTTCAGTCCAGTGGAGCGACAAAAAC
TTGGATTCCGTCGTCGAAGGCTCATCCCAGTCCTTGATCGAAGACGTCGAGACGCTTTCGAAGGCGAGAGGCCTG
TTCCGAGGATTCATCTACATGAACTATGCCGGGAAAAGCCAAGACGTCTTCGGCCGATACGGTCGAGAGAGCTAC
GATCGTTTAAAAAAGACGGCATTCCGTTGGGACCCCAATGGACTTCTCGAAGATCTCTGGAAGGGGTATTTTCAA
GTCCGCAACTTTGAGCATGACTAG
Gene >Hirsu2|6429
ATGGGGCCCTCCCCGTCCAAGCTGGCTCTCAAGGCCATCGCCGCGGCCTGCTTGGCCTCGGCCGCGGCCGCCGAC
CCGGACAGGGACCCAGTACGGAAGCGGAGCCGATTCTTGCTCCTTGGACGCCGAGGCTGATCCTTTCTCATCCGC
AGTGCCGTGCCTTGGCCAGGGCTCTGCCCGGGGAGGTCCACCTCCCGGACTCGGCCGCGTACCGGGCCGAGAACA
TGTACTGGTCCAACCGGCAGGCCGAGGCCCGTCCGCGATGCTTCGTGACGCCCAGGGGCACCATGGAGGTCTCCC
GGGCCCTGAAGACGCTGACGGAGCTGCGGGCGCCCTTCAGCGTCAAGTCCGGCGGACACACGGCGTTCGAGGGGG
GGTCCGGCGCCGATAAAGGCGTCACCATCGACCTCGTGAATTTCCGCGAGGTCACCGTATGGTCCGACAACAAGA
CCGTCACGGTCGGCGCCGGCAACCGATGGATCAACGTCTCGCGCGCGCTCGACCCCCTGGGCCTGGCCGTCGTGG
GCGGACGGGCCGCCGACGTCGGCGTCAGCGGCCTGATCCTCGGTGGCGGCATCTCCTATTTCTCGGGCACGCGCG
GCTGGGCGTGCGACAACGTCCGCTCGTTCCGCGTCGTCGTCTCTTCGGGGGACGCGGTCACGGCGTCGCCCACCG
AAAATCAGGATCTGTACTGGGCCCTCCGCGGCGGCGGCGGCTCCAGCTTCGGCATCGTCGTCTCCTTCGACCTCG
AGGCCTTCCCGCAAGCCGACCTGTGGACAAACTCGATCATCTTCCCCGGGGCCTCGAACAAGACCTTGATCCCCC
TGTTTACCCATCTCAGCAACCGGGGCCTGGTGGAGAACCCCCAGGCTCACGCCTACTTCGTCCTGAGCTACCAAC
CTGGCATCAGCGGCTTCGCCGTTCTGACCAGCTTCTTCCAGTCGACGCCACTGCCGAACCACGCCGTACCGTCCG
TCTTCCAGCCGTTTCAGTCCGTCCCTGGAGCCGTTTCCAACGTAGCGCAGGTGGTCAACATCTCGACCCAGTCCA
TGGCCATTGACCAGCCTTCGGGCTCTCGCCAGACCTGGTGGGACACGTCTGTCTCCATGGCCTCGCCCAAGCTTT
TCGAAGACATTGTCTCCATGTACGAGGACTATGTGCACAAGCTGCTCGAAGCCGCCAAGGGCTCCAAGTTGACTA
CCTTTCTCGTTTTCCAGCCCATCTCCCAGAACGTCGTCGATGCCATGCAGAAGAATGGCGGAAACGCGCTGGGCC
TCAAGCCCAGCGATGGGCCACTGATGATTGTGCAGATTTCAGTCCAGTGGAGCGACAAAAACTTGGATTCCGTCG
TCGAAGGCTCATCCCAGTCCTTGATCGAAGACGTCGAGACGCTTTCGAAGGCGAGAGGCCTGTTCCGAGGATTCA
TCTACATGAACTATGCCGGGAAAAGCCAAGACGTCTTCGGCCGATACGGTCGAGAGAGCTACGATCGTTTAAAAA
AGACGGCATTCCGTTGGGACCCCAATGGACTTCTCGAAGATCTCTGGAAGGGGTATTTTCAAGTCCGCAACTTTG
AGCATGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail