Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6426
Gene name
LocationContig_33:31351..33857
Strand+
Gene length (bp)2506
Transcript length (bp)2421
Coding sequence length (bp)2421
Protein length (aa) 807

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00550 PP-binding Phosphopantetheine attachment site 5.5E-12 329 390
PF00550 PP-binding Phosphopantetheine attachment site 1.5E-10 435 498
PF00975 Thioesterase Thioesterase domain 1.0E-21 554 667
PF14765 PS-DH Polyketide synthase dehydratase 1.3E-13 5 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 3 783 2.0E-159
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 3 799 1.0E-91
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 435 799 4.0E-46
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 3 452 2.0E-37
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 549 655 5.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 3 783 2.0E-159
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 3 799 1.0E-91
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 435 799 4.0E-46
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 3 452 2.0E-37
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 549 655 5.0E-10
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 546 655 6.0E-08
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 458 658 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6426
MQTLYGDIALTVARALVEGNKGVRFTGFDVSDMKIDRPLIALPSETTHLFRASASADWASQIVTLSLYSVDEAGN
RTASHAAVNVRLVEDQAIWLNEWKPTAYLINGRIASLESAVASGNSHKLKRSMVYKLFGSLVDYSQAYQGMQEVI
LDSDELEATAKVSFRVDDQGFVMNPHWIDSLGHLAGFIMNGNENMPSHKQVFINHGWSRLRFGENPEAGKVYTTY
NKMQLVQGKLYAGDTYVLDGQRIVAIFEKVAFQGVPRQVLDNLLPGKTVTPRAAKLGGTTISAATTTISAATTTI
SAETTTKAAQRQAAAPPASKASQSGDFSRVLTIIAEEVRIELSELQPDSQFADFGLDSLLSLTVTSRINDEIGID
LPWKLFAAYPTVKDLQSLIDPLSSVPRETPELTASSHTGDDQSRDSTSAASEDENFRFIIRQTIADETGTPAEDL
VPSACLADLGVDSLLSLSIADSLTEALGAHVSSSHFLENGTLEEMEAALGKALGLHVADLVGASSMNAAVPMHVP
IALEDNIVSGPPHATSIVLHGVRNAVPRRTLFLLPDGSGSAASYASLAKLDPGLAVYGLNCPWRTTPEEMRRLGV
TTSQVVAKFVAEIRSRQAHGPYFLGGWSAGGIFAYEAARALMAAGETVEKLLLVDAPNPIGLENPPSRMFDFFES
AGVFGGMGGAGKAVPRWLRHHFDSVVNMLDGYRPEALPGAPPTLAIYARDGICKDRGTPRIETRPDDPREMLWLL
HDRTDFSASGWSSLLGPGNVAVLVLDNVNHFTMMNDGPHMDIMREHVRRQILPEGI*
Coding >Hirsu2|6426
ATGCAGACTCTGTACGGCGATATCGCACTGACCGTGGCGAGGGCTCTGGTGGAGGGAAACAAGGGGGTCCGCTTC
ACCGGTTTCGACGTGTCCGACATGAAGATCGACCGCCCCCTGATTGCGCTCCCGTCGGAGACGACTCACCTGTTT
AGAGCCTCGGCCTCGGCCGACTGGGCGTCACAAATCGTCACGCTATCGCTATATAGCGTCGACGAGGCCGGGAAC
CGTACCGCAAGTCATGCCGCCGTCAACGTCCGACTGGTTGAAGACCAGGCCATCTGGCTCAACGAGTGGAAGCCC
ACGGCGTACCTCATCAACGGCCGGATCGCCTCGCTCGAGTCGGCCGTGGCAAGTGGAAACAGCCACAAGCTGAAG
CGATCCATGGTCTACAAGCTATTCGGCTCGCTCGTGGATTACAGCCAGGCGTATCAGGGCATGCAGGAGGTCATT
CTCGACAGCGACGAGCTCGAGGCAACGGCCAAGGTGTCGTTCCGCGTCGATGACCAAGGCTTCGTAATGAACCCG
CACTGGATCGACAGCCTGGGCCATCTTGCCGGCTTCATCATGAACGGAAACGAAAACATGCCGTCGCACAAGCAA
GTCTTTATCAACCACGGCTGGAGCCGGCTACGCTTTGGCGAGAATCCCGAGGCGGGCAAGGTGTACACCACGTAC
AACAAGATGCAGCTTGTCCAGGGGAAGCTGTACGCGGGCGATACATACGTCCTCGACGGGCAGCGTATTGTCGCC
ATCTTCGAAAAAGTCGCTTTCCAAGGAGTTCCGCGTCAAGTTCTCGACAACCTGCTTCCCGGAAAGACAGTCACA
CCTCGAGCGGCGAAGCTCGGCGGAACGACCATCTCGGCCGCGACGACGACCATCTCGGCCGCGACGACGACCATC
TCGGCCGAGACGACGACCAAGGCAGCTCAGCGTCAGGCCGCGGCCCCGCCCGCGAGCAAGGCAAGCCAGTCTGGG
GACTTCAGTCGTGTCTTGACCATCATTGCCGAGGAGGTCAGGATAGAGCTGTCGGAGCTTCAGCCCGATAGCCAG
TTTGCCGATTTCGGGCTTGACTCGCTGCTCTCCCTGACGGTGACGTCGCGGATCAACGATGAGATTGGCATAGAC
CTCCCCTGGAAGCTGTTTGCGGCGTACCCGACCGTCAAGGACTTGCAGTCCCTCATCGACCCCCTCAGCAGCGTG
CCGAGAGAAACGCCCGAGCTCACGGCGAGCTCGCACACGGGGGACGACCAGTCTCGGGATTCGACGTCTGCGGCA
AGCGAGGACGAGAACTTCAGGTTCATCATCCGGCAGACGATCGCCGACGAGACCGGGACGCCGGCCGAGGATCTC
GTGCCGTCTGCCTGCCTGGCGGACCTCGGAGTGGACTCGCTGCTGAGTCTCAGCATCGCCGACTCTCTCACGGAG
GCCCTCGGGGCGCACGTGTCCAGCAGCCACTTCTTGGAGAACGGGACGCTGGAGGAGATGGAAGCTGCGCTGGGC
AAGGCTCTGGGCCTGCATGTCGCCGATCTCGTGGGCGCGAGCAGCATGAACGCCGCGGTGCCGATGCATGTGCCG
ATCGCGCTGGAGGACAACATCGTCTCCGGCCCTCCGCACGCCACATCCATCGTGCTCCACGGCGTGCGGAATGCG
GTCCCGAGGCGGACTCTCTTCCTGCTCCCCGACGGCTCCGGATCGGCCGCCTCGTACGCCTCGCTCGCAAAGCTG
GACCCCGGCCTGGCGGTCTACGGACTCAACTGCCCGTGGCGAACGACGCCAGAAGAGATGAGGCGGCTGGGCGTG
ACGACTTCGCAGGTCGTCGCCAAGTTCGTGGCCGAGATCCGGAGCCGCCAGGCACACGGGCCCTACTTCCTGGGC
GGCTGGTCGGCCGGAGGCATCTTCGCCTACGAGGCCGCGCGGGCGCTCATGGCCGCGGGCGAGACGGTCGAGAAG
CTGCTGCTGGTCGACGCGCCGAACCCGATCGGGCTCGAGAACCCGCCGTCGAGGATGTTCGACTTCTTCGAGAGC
GCCGGCGTCTTCGGCGGCATGGGCGGCGCCGGCAAGGCCGTGCCGCGCTGGCTCCGCCATCACTTCGACTCCGTC
GTCAACATGCTGGACGGCTACCGGCCCGAGGCCCTGCCCGGGGCGCCGCCGACGCTCGCCATCTATGCCCGGGAC
GGCATCTGCAAAGACCGGGGCACGCCGCGGATCGAGACGCGGCCGGACGATCCGCGCGAGATGCTGTGGCTCCTG
CACGACCGCACCGACTTCTCGGCCAGCGGCTGGTCCTCGCTGCTTGGCCCGGGCAATGTGGCCGTCCTTGTGCTG
GACAACGTGAACCACTTCACGATGATGAACGACGGGCCTCACATGGATATCATGCGCGAGCATGTCCGACGGCAA
ATCTTGCCAGAAGGGATTTAA
Transcript >Hirsu2|6426
ATGCAGACTCTGTACGGCGATATCGCACTGACCGTGGCGAGGGCTCTGGTGGAGGGAAACAAGGGGGTCCGCTTC
ACCGGTTTCGACGTGTCCGACATGAAGATCGACCGCCCCCTGATTGCGCTCCCGTCGGAGACGACTCACCTGTTT
AGAGCCTCGGCCTCGGCCGACTGGGCGTCACAAATCGTCACGCTATCGCTATATAGCGTCGACGAGGCCGGGAAC
CGTACCGCAAGTCATGCCGCCGTCAACGTCCGACTGGTTGAAGACCAGGCCATCTGGCTCAACGAGTGGAAGCCC
ACGGCGTACCTCATCAACGGCCGGATCGCCTCGCTCGAGTCGGCCGTGGCAAGTGGAAACAGCCACAAGCTGAAG
CGATCCATGGTCTACAAGCTATTCGGCTCGCTCGTGGATTACAGCCAGGCGTATCAGGGCATGCAGGAGGTCATT
CTCGACAGCGACGAGCTCGAGGCAACGGCCAAGGTGTCGTTCCGCGTCGATGACCAAGGCTTCGTAATGAACCCG
CACTGGATCGACAGCCTGGGCCATCTTGCCGGCTTCATCATGAACGGAAACGAAAACATGCCGTCGCACAAGCAA
GTCTTTATCAACCACGGCTGGAGCCGGCTACGCTTTGGCGAGAATCCCGAGGCGGGCAAGGTGTACACCACGTAC
AACAAGATGCAGCTTGTCCAGGGGAAGCTGTACGCGGGCGATACATACGTCCTCGACGGGCAGCGTATTGTCGCC
ATCTTCGAAAAAGTCGCTTTCCAAGGAGTTCCGCGTCAAGTTCTCGACAACCTGCTTCCCGGAAAGACAGTCACA
CCTCGAGCGGCGAAGCTCGGCGGAACGACCATCTCGGCCGCGACGACGACCATCTCGGCCGCGACGACGACCATC
TCGGCCGAGACGACGACCAAGGCAGCTCAGCGTCAGGCCGCGGCCCCGCCCGCGAGCAAGGCAAGCCAGTCTGGG
GACTTCAGTCGTGTCTTGACCATCATTGCCGAGGAGGTCAGGATAGAGCTGTCGGAGCTTCAGCCCGATAGCCAG
TTTGCCGATTTCGGGCTTGACTCGCTGCTCTCCCTGACGGTGACGTCGCGGATCAACGATGAGATTGGCATAGAC
CTCCCCTGGAAGCTGTTTGCGGCGTACCCGACCGTCAAGGACTTGCAGTCCCTCATCGACCCCCTCAGCAGCGTG
CCGAGAGAAACGCCCGAGCTCACGGCGAGCTCGCACACGGGGGACGACCAGTCTCGGGATTCGACGTCTGCGGCA
AGCGAGGACGAGAACTTCAGGTTCATCATCCGGCAGACGATCGCCGACGAGACCGGGACGCCGGCCGAGGATCTC
GTGCCGTCTGCCTGCCTGGCGGACCTCGGAGTGGACTCGCTGCTGAGTCTCAGCATCGCCGACTCTCTCACGGAG
GCCCTCGGGGCGCACGTGTCCAGCAGCCACTTCTTGGAGAACGGGACGCTGGAGGAGATGGAAGCTGCGCTGGGC
AAGGCTCTGGGCCTGCATGTCGCCGATCTCGTGGGCGCGAGCAGCATGAACGCCGCGGTGCCGATGCATGTGCCG
ATCGCGCTGGAGGACAACATCGTCTCCGGCCCTCCGCACGCCACATCCATCGTGCTCCACGGCGTGCGGAATGCG
GTCCCGAGGCGGACTCTCTTCCTGCTCCCCGACGGCTCCGGATCGGCCGCCTCGTACGCCTCGCTCGCAAAGCTG
GACCCCGGCCTGGCGGTCTACGGACTCAACTGCCCGTGGCGAACGACGCCAGAAGAGATGAGGCGGCTGGGCGTG
ACGACTTCGCAGGTCGTCGCCAAGTTCGTGGCCGAGATCCGGAGCCGCCAGGCACACGGGCCCTACTTCCTGGGC
GGCTGGTCGGCCGGAGGCATCTTCGCCTACGAGGCCGCGCGGGCGCTCATGGCCGCGGGCGAGACGGTCGAGAAG
CTGCTGCTGGTCGACGCGCCGAACCCGATCGGGCTCGAGAACCCGCCGTCGAGGATGTTCGACTTCTTCGAGAGC
GCCGGCGTCTTCGGCGGCATGGGCGGCGCCGGCAAGGCCGTGCCGCGCTGGCTCCGCCATCACTTCGACTCCGTC
GTCAACATGCTGGACGGCTACCGGCCCGAGGCCCTGCCCGGGGCGCCGCCGACGCTCGCCATCTATGCCCGGGAC
GGCATCTGCAAAGACCGGGGCACGCCGCGGATCGAGACGCGGCCGGACGATCCGCGCGAGATGCTGTGGCTCCTG
CACGACCGCACCGACTTCTCGGCCAGCGGCTGGTCCTCGCTGCTTGGCCCGGGCAATGTGGCCGTCCTTGTGCTG
GACAACGTGAACCACTTCACGATGATGAACGACGGGCCTCACATGGATATCATGCGCGAGCATGTCCGACGGCAA
ATCTTGCCAGAAGGGATTTAA
Gene >Hirsu2|6426
ATGCAGACTCTGTACGGCGATATCGCACTGACCGTGGCGAGGGCTCTGGTGGAGGGAAACAAGGGGGTCCGCTTC
ACCGGTTTCGACGTGTCCGACATGAAGATCGACCGCCCCCTGATTGCGCTCCCGTCGGAGACGACTCACCTGTTT
AGAGCCTCGGCCTCGGCCGACTGGGCGTCACAAATCGTCACGCTATCGCTATATAGCGTCGACGAGGCCGGGAAC
CGTACCGCAAGTCATGCCGCCGTCAACGTCCGACTGGTTGAAGACCAGGCCATCTGGCTCAACGAGTGGAAGCCC
ACGGCGTACCTCATCAACGGCCGGATCGCCTCGCTCGAGTCGGCCGTGGCAAGTGGAAACAGCCACAAGCTGAAG
CGATCCATGGTCTACAAGCTATTCGGCTCGCTCGTGGATTACAGCCAGGCGTATCAGGGCATGCAGGAGGTCATT
CTCGACAGCGACGAGCTCGAGGCAACGGCCAAGGTGTCGTTCCGCGTCGATGACCAAGGCTTCGTAATGAACCCG
CACTGGATCGACAGCCTGGGCCATCTTGCCGGCTTCATCATGAACGGAAACGAAAACATGCCGTCGCACAAGCAA
GTCTTTATCAACCACGGCTGGAGCCGGCTACGCTTTGGCGAGAATCCCGAGGCGGGCAAGGTGTACACCACGTAC
AACAAGATGCAGCTTGTCCAGGGGAAGCTGTACGCGGGCGATACATACGTCCTCGACGGGCAGCGTATTGTCGCC
ATCTTCGAAAAAGTCGCTGTGAGTAGAGTCCCCTGAAGCTCGTTGAGTTGTCTTGGCCGGTCTCGACTGAGGAAG
AGGATTCCCTAACCCCCCCTTTTCACAGTTCCAAGGAGTTCCGCGTCAAGTTCTCGACAACCTGCTTCCCGGAAA
GACAGTCACACCTCGAGCGGCGAAGCTCGGCGGAACGACCATCTCGGCCGCGACGACGACCATCTCGGCCGCGAC
GACGACCATCTCGGCCGAGACGACGACCAAGGCAGCTCAGCGTCAGGCCGCGGCCCCGCCCGCGAGCAAGGCAAG
CCAGTCTGGGGACTTCAGTCGTGTCTTGACCATCATTGCCGAGGAGGTCAGGATAGAGCTGTCGGAGCTTCAGCC
CGATAGCCAGTTTGCCGATTTCGGGCTTGACTCGCTGCTCTCCCTGACGGTGACGTCGCGGATCAACGATGAGAT
TGGCATAGACCTCCCCTGGAAGCTGTTTGCGGCGTACCCGACCGTCAAGGACTTGCAGTCCCTCATCGACCCCCT
CAGCAGCGTGCCGAGAGAAACGCCCGAGCTCACGGCGAGCTCGCACACGGGGGACGACCAGTCTCGGGATTCGAC
GTCTGCGGCAAGCGAGGACGAGAACTTCAGGTTCATCATCCGGCAGACGATCGCCGACGAGACCGGGACGCCGGC
CGAGGATCTCGTGCCGTCTGCCTGCCTGGCGGACCTCGGAGTGGACTCGCTGCTGAGTCTCAGCATCGCCGACTC
TCTCACGGAGGCCCTCGGGGCGCACGTGTCCAGCAGCCACTTCTTGGAGAACGGGACGCTGGAGGAGATGGAAGC
TGCGCTGGGCAAGGCTCTGGGCCTGCATGTCGCCGATCTCGTGGGCGCGAGCAGCATGAACGCCGCGGTGCCGAT
GCATGTGCCGATCGCGCTGGAGGACAACATCGTCTCCGGCCCTCCGCACGCCACATCCATCGTGCTCCACGGCGT
GCGGAATGCGGTCCCGAGGCGGACTCTCTTCCTGCTCCCCGACGGCTCCGGATCGGCCGCCTCGTACGCCTCGCT
CGCAAAGCTGGACCCCGGCCTGGCGGTCTACGGACTCAACTGCCCGTGGCGAACGACGCCAGAAGAGATGAGGCG
GCTGGGCGTGACGACTTCGCAGGTCGTCGCCAAGTTCGTGGCCGAGATCCGGAGCCGCCAGGCACACGGGCCCTA
CTTCCTGGGCGGCTGGTCGGCCGGAGGCATCTTCGCCTACGAGGCCGCGCGGGCGCTCATGGCCGCGGGCGAGAC
GGTCGAGAAGCTGCTGCTGGTCGACGCGCCGAACCCGATCGGGCTCGAGAACCCGCCGTCGAGGATGTTCGACTT
CTTCGAGAGCGCCGGCGTCTTCGGCGGCATGGGCGGCGCCGGCAAGGCCGTGCCGCGCTGGCTCCGCCATCACTT
CGACTCCGTCGTCAACATGCTGGACGGCTACCGGCCCGAGGCCCTGCCCGGGGCGCCGCCGACGCTCGCCATCTA
TGCCCGGGACGGCATCTGCAAAGACCGGGGCACGCCGCGGATCGAGACGCGGCCGGACGATCCGCGCGAGATGCT
GTGGCTCCTGCACGACCGCACCGACTTCTCGGCCAGCGGCTGGTCCTCGCTGCTTGGCCCGGGCAATGTGGCCGT
CCTTGTGCTGGACAACGTGAACCACTTCACGATGATGAACGACGGGCCTCACATGGATATCATGCGCGAGCATGT
CCGACGGCAAATCTTGCCAGAAGGGATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail