Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6422
Gene name
LocationContig_33:18487..19923
Strand+
Gene length (bp)1436
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11309 DUF3112 Protein of unknown function (DUF3112) 1.9E-07 253 316

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 70 92 22
2 99 121 22
3 131 153 22
4 174 196 22
5 211 233 22
6 253 275 22
7 290 312 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6422
MATLLGTVTRAALLNVAEANNAGQGQSQISSLGLRAVTDSNAADAEKPRIDPADGGFPGGVPERKVDVPITAIFL
LLFGLGAFTHITVYRSNSKRGHKFLLSDLMFDFCMVRVATCVFRITWAFTSPRGVILAATIFENGGAIVLFAVNL
FLAQRLVRAMQPVIGWHPVFSHFSFLLIISVPATIIMNIVALSISFFSVDKPDRLEATVDVLKFGVSWSMMLVVM
PLIWVFLASMKPGPTPENFGEGDFRAKASLVVFSSATLTAGAAVRLAALINPESPEAKSVLFSKAVFYTTGFVPE
IVTVAAYAFFRIDLIFHIPNGASGPGDYTPVSSGPDSAPRLWTAAEIQEEISKFYSRSDIVFDVVLPPPGGQQEQ
PIPDYMYDSNTLVDGEKGTYAPSKAYDNQSMPPRSLQVQRSADHMQVSKSQMDGEWA*
Coding >Hirsu2|6422
ATGGCGACTCTACTGGGCACAGTCACAAGAGCGGCACTACTTAATGTCGCCGAGGCCAATAATGCCGGACAGGGC
CAGAGCCAAATATCAAGTCTAGGCCTACGAGCTGTGACCGACAGCAACGCGGCGGACGCCGAGAAACCAAGAATC
GATCCGGCCGATGGAGGGTTCCCAGGCGGCGTCCCGGAGCGCAAGGTCGACGTTCCTATCACGGCCATCTTCCTG
CTGTTGTTTGGCCTGGGAGCCTTCACGCACATCACCGTCTACCGATCCAACTCCAAGAGAGGCCACAAGTTCCTT
CTGTCAGACCTCATGTTCGACTTCTGTATGGTCCGGGTCGCGACCTGCGTCTTTCGCATCACCTGGGCTTTCACA
AGCCCCCGTGGCGTCATCCTGGCTGCCACCATCTTCGAGAACGGCGGCGCCATCGTCCTCTTCGCCGTCAACCTC
TTCCTCGCACAGCGGCTCGTTCGAGCCATGCAGCCCGTGATCGGGTGGCACCCCGTCTTCAGCCATTTCTCATTT
CTACTCATAATCTCGGTGCCGGCCACCATCATCATGAACATAGTCGCTCTCTCGATAAGCTTCTTCAGCGTTGAC
AAGCCGGATCGGCTGGAGGCCACCGTCGATGTCTTGAAGTTCGGCGTCTCGTGGAGCATGATGCTGGTCGTCATG
CCGCTGATATGGGTCTTCCTGGCGAGTATGAAGCCCGGGCCGACGCCGGAGAACTTCGGAGAGGGCGATTTCCGT
GCAAAGGCATCCTTGGTCGTCTTCAGTTCGGCAACGTTGACGGCCGGCGCCGCGGTGAGGCTGGCGGCACTGATA
AACCCGGAGAGCCCCGAGGCGAAATCGGTGCTGTTTAGCAAGGCCGTCTTCTACACCACCGGCTTCGTCCCGGAG
ATCGTCACGGTAGCAGCTTATGCCTTCTTCCGCATTGACTTGATCTTTCACATTCCGAACGGAGCCAGCGGCCCA
GGAGACTACACCCCAGTCTCCAGCGGCCCAGACTCGGCACCTCGCCTGTGGACAGCCGCCGAGATCCAGGAGGAG
ATCAGCAAGTTCTATTCCCGCTCCGACATCGTTTTCGATGTTGTTTTGCCTCCTCCTGGTGGCCAACAAGAGCAG
CCGATTCCTGATTACATGTACGATTCGAATACTCTCGTGGACGGAGAAAAGGGCACCTATGCGCCGAGCAAAGCA
TACGACAACCAATCAATGCCACCCAGAAGCCTTCAAGTCCAGAGATCAGCAGATCACATGCAGGTGTCCAAGAGC
CAAATGGACGGTGAATGGGCCTAG
Transcript >Hirsu2|6422
ATGGCGACTCTACTGGGCACAGTCACAAGAGCGGCACTACTTAATGTCGCCGAGGCCAATAATGCCGGACAGGGC
CAGAGCCAAATATCAAGTCTAGGCCTACGAGCTGTGACCGACAGCAACGCGGCGGACGCCGAGAAACCAAGAATC
GATCCGGCCGATGGAGGGTTCCCAGGCGGCGTCCCGGAGCGCAAGGTCGACGTTCCTATCACGGCCATCTTCCTG
CTGTTGTTTGGCCTGGGAGCCTTCACGCACATCACCGTCTACCGATCCAACTCCAAGAGAGGCCACAAGTTCCTT
CTGTCAGACCTCATGTTCGACTTCTGTATGGTCCGGGTCGCGACCTGCGTCTTTCGCATCACCTGGGCTTTCACA
AGCCCCCGTGGCGTCATCCTGGCTGCCACCATCTTCGAGAACGGCGGCGCCATCGTCCTCTTCGCCGTCAACCTC
TTCCTCGCACAGCGGCTCGTTCGAGCCATGCAGCCCGTGATCGGGTGGCACCCCGTCTTCAGCCATTTCTCATTT
CTACTCATAATCTCGGTGCCGGCCACCATCATCATGAACATAGTCGCTCTCTCGATAAGCTTCTTCAGCGTTGAC
AAGCCGGATCGGCTGGAGGCCACCGTCGATGTCTTGAAGTTCGGCGTCTCGTGGAGCATGATGCTGGTCGTCATG
CCGCTGATATGGGTCTTCCTGGCGAGTATGAAGCCCGGGCCGACGCCGGAGAACTTCGGAGAGGGCGATTTCCGT
GCAAAGGCATCCTTGGTCGTCTTCAGTTCGGCAACGTTGACGGCCGGCGCCGCGGTGAGGCTGGCGGCACTGATA
AACCCGGAGAGCCCCGAGGCGAAATCGGTGCTGTTTAGCAAGGCCGTCTTCTACACCACCGGCTTCGTCCCGGAG
ATCGTCACGGTAGCAGCTTATGCCTTCTTCCGCATTGACTTGATCTTTCACATTCCGAACGGAGCCAGCGGCCCA
GGAGACTACACCCCAGTCTCCAGCGGCCCAGACTCGGCACCTCGCCTGTGGACAGCCGCCGAGATCCAGGAGGAG
ATCAGCAAGTTCTATTCCCGCTCCGACATCGTTTTCGATGTTGTTTTGCCTCCTCCTGGTGGCCAACAAGAGCAG
CCGATTCCTGATTACATGTACGATTCGAATACTCTCGTGGACGGAGAAAAGGGCACCTATGCGCCGAGCAAAGCA
TACGACAACCAATCAATGCCACCCAGAAGCCTTCAAGTCCAGAGATCAGCAGATCACATGCAGGTGTCCAAGAGC
CAAATGGACGGTGAATGGGCCTAG
Gene >Hirsu2|6422
ATGGCGACTCTACTGGGCACAGTCACAAGAGCGGCACTACTTAATGTCGCCGAGGCCAATAATGCCGGACAGGGC
CAGAGCCAAATATCAAGTCTAGGCCTACGAGCTGTGACCGACAGCAACGCGGCGGACGCCGAGAAACCAAGAATC
GATCCGGCCGATGGAGGGTTCCCAGGCGGCGTCCCGGAGCGCAAGGTCGACGTTCCTATCACGGCCATCTTCCTG
CTGTTGTTTGGCCTGGGAGCCTTCACGCACATCACCGTCTACCGATCCAACTCCAAGAGAGGCCACAAGTTCCTT
CTGTCAGACCTCATGTTCGACTTCTGTATGGTCCGGGTCGCGACCTGCGTCTTTCGCATCACCTGGGCTTTCACA
AGCCCCCGTGGCGTCATCCTGGCTGCCACCATCTTCGAGAACGGCGGGTGAGTTGCCATAGATTTTGATTGGGAA
TCATCTTCAGGAAGCACCTCGCTGACCTCGTGTGCAGCGCCATCGTCCTCTTCGCCGTCAACCTCTTCCTCGCAC
AGCGGCTCGTTCGAGCCATGCAGCCCGTGATCGGGTGGCACCCCGTCTTCAGCCATTTCTCATTTCTACTCATAA
TCTCGGTGCCGGCCACCATCATCATGAACATAGTCGCTCTCTCGATAAGCTTCTTCAGCGTTGACAAGCCGGATC
GGCTGGAGGCCACCGTCGATGTCTTGAAGTTCGGCGTCTCGTGGAGCATGATGCTGGTCGTCATGCCGCTGATAT
GGGTCTTCCTGGCGAGTATGAAGCCCGGGCCGACGCCGGAGAACTTCGGAGAGGGCGATTTCCGTGCAAAGGCAT
CCTTGGTCGTCTTCAGTTCGGCAACGTTGACGGCCGGCGCCGCGGTGAGGCTGGCGGCACTGATAAACCCGGAGA
GCCCCGAGGCGAAATCGGTGCTGTTTAGCAAGGCCGTCTTCTACACCACCGGCTTCGTCCCGGAGATCGTCACGG
TAGCAGCTTATGCCTTCTTCCGCATTGACTTGATCTTTCACATTCCGAACGGAGCCAGCGGCCCAGGAGACTACA
CCCCAGTCTCCAGCGGCCCAGACTCGGCACCTCGCCTGTGGACAGCCGCCGAGATCCAGGAGGAGATCAGCAAGT
TCTATTCCCGCTCCGACATCGTTTTCGATGTTGTTTTGCCTCCTCCTGGTGGCCAACAAGAGCAGCCGATTCCTG
ATTACATGTACGATTCGAATACTCTCGTGGACGGAGAAAAGGGCACCTATGCGCCGAGCAAAGCATACGACAACC
AATCAATGCCACCCAGAAGCCTTCAAGTCCAGAGAGTGAGTCGGAGGCAGTCCCTGATTCAGGCTCTTACTCCAC
GGAGAGGGCTTCCGGCTAGACCGACATGGCAGTCAGCAGATCACATGCAGGTGTCCAAGAGCCAAATGGACGGTG
AATGGGCCTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail