Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6419
Gene name
LocationContig_33:4430..5106
Strand-
Gene length (bp)676
Transcript length (bp)609
Coding sequence length (bp)609
Protein length (aa) 203

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11991 Trp_DMAT Tryptophan dimethylallyltransferase 3.4E-42 1 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 1 180 3.0E-11
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 1 154 1.0E-10
sp|P0CT20|DMAW1_CLAPU Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea GN=dmaW1 PE=1 SV=1 1 180 2.0E-10
sp|Q6X2E3|DMAW_EPINE Tryptophan dimethylallyltransferase OS=Epichloe typhina x Neotyphodium lolii GN=dmaW PE=3 SV=1 1 154 7.0E-10
sp|Q6X2E1|DMAW2_EPICN Tryptophan dimethylallyltransferase 2 OS=Epichloe coenophiala GN=dmaW2 PE=3 SV=1 1 154 7.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|M1WA41|DMAW1_CLAP2 Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea (strain 20.1) GN=dmaW1 PE=3 SV=1 1 180 3.0E-11
sp|Q9C141|DMAW2_CLAP2 Tryptophan dimethylallyltransferase 2 OS=Claviceps purpurea (strain 20.1) GN=dmaW2 PE=3 SV=1 1 154 1.0E-10
sp|P0CT20|DMAW1_CLAPU Tryptophan dimethylallyltransferase 1 OS=Claviceps purpurea GN=dmaW1 PE=1 SV=1 1 180 2.0E-10
sp|Q6X2E3|DMAW_EPINE Tryptophan dimethylallyltransferase OS=Epichloe typhina x Neotyphodium lolii GN=dmaW PE=3 SV=1 1 154 7.0E-10
sp|Q6X2E1|DMAW2_EPICN Tryptophan dimethylallyltransferase 2 OS=Epichloe coenophiala GN=dmaW2 PE=3 SV=1 1 154 7.0E-10
sp|Q6X2E2|DMAW1_EPICN Tryptophan dimethylallyltransferase 1 OS=Epichloe coenophiala GN=dmaW1 PE=3 SV=1 1 154 8.0E-10
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 1 154 4.0E-09
sp|Q50EL0|DMAW_ASPFU Tryptophan dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT2 PE=1 SV=2 1 154 5.0E-09
sp|Q4WZ67|FGPT1_ASPFU Fumigaclavine A dimethylallyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=fgaPT1 PE=1 SV=1 2 181 8.0E-09
sp|Q6X1E1|DMAW_BALOB Tryptophan dimethylallyltransferase OS=Balansia obtecta GN=dmaW PE=3 SV=1 1 154 5.0E-07
sp|Q12594|DMAW_CLAFS Tryptophan dimethylallyltransferase OS=Claviceps fusiformis GN=dmaW PE=1 SV=1 1 113 7.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009820 alkaloid metabolic process Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6419
MLDSAGYAIERQYDALLFHYYWTVPYLGSAPGEDGKLQVPSILGTGIALKYSWKWNTTASSPDIRYTLEAMNRFS
GTEMDPLNQDPARELLHRLKATLPSIDLTWSNHFFSTLYDHDRSKYMEESKAGARFTTTVMMAVEFVEKGPVTKT
YFIPRKLGHGHGQIPIAMWEDSLAQLDPQNAARGAMYEFMKTDPEGRLLSPL*
Coding >Hirsu2|6419
ATGTTGGACTCGGCAGGATACGCGATCGAAAGGCAGTACGATGCGCTTCTCTTCCACTACTATTGGACCGTCCCC
TACTTGGGCTCAGCACCAGGCGAGGACGGCAAACTCCAGGTGCCCTCGATCCTGGGAACCGGGATAGCGCTGAAG
TACTCCTGGAAATGGAACACGACCGCATCATCGCCCGATATTCGCTATACCCTCGAGGCCATGAACCGGTTCAGC
GGCACCGAGATGGACCCCCTGAACCAGGATCCGGCGCGCGAGCTCCTGCACCGCCTCAAGGCCACGCTTCCGTCC
ATCGACCTCACATGGTCCAACCACTTCTTCTCGACCTTGTACGACCACGACCGGTCCAAGTACATGGAGGAGTCC
AAGGCCGGCGCGCGCTTCACGACGACCGTCATGATGGCCGTCGAATTCGTCGAAAAGGGGCCGGTGACGAAGACG
TATTTCATACCGCGGAAGCTGGGCCACGGCCACGGCCAGATCCCCATCGCGATGTGGGAGGACAGCCTGGCGCAG
CTGGATCCCCAGAATGCAGCTCGTGGGGCAATGTACGAATTTATGAAGACCGATCCCGAGGGCCGGCTGCTCAGC
CCCTTGTAA
Transcript >Hirsu2|6419
ATGTTGGACTCGGCAGGATACGCGATCGAAAGGCAGTACGATGCGCTTCTCTTCCACTACTATTGGACCGTCCCC
TACTTGGGCTCAGCACCAGGCGAGGACGGCAAACTCCAGGTGCCCTCGATCCTGGGAACCGGGATAGCGCTGAAG
TACTCCTGGAAATGGAACACGACCGCATCATCGCCCGATATTCGCTATACCCTCGAGGCCATGAACCGGTTCAGC
GGCACCGAGATGGACCCCCTGAACCAGGATCCGGCGCGCGAGCTCCTGCACCGCCTCAAGGCCACGCTTCCGTCC
ATCGACCTCACATGGTCCAACCACTTCTTCTCGACCTTGTACGACCACGACCGGTCCAAGTACATGGAGGAGTCC
AAGGCCGGCGCGCGCTTCACGACGACCGTCATGATGGCCGTCGAATTCGTCGAAAAGGGGCCGGTGACGAAGACG
TATTTCATACCGCGGAAGCTGGGCCACGGCCACGGCCAGATCCCCATCGCGATGTGGGAGGACAGCCTGGCGCAG
CTGGATCCCCAGAATGCAGCTCGTGGGGCAATGTACGAATTTATGAAGACCGATCCCGAGGGCCGGCTGCTCAGC
CCCTTGTAA
Gene >Hirsu2|6419
ATGTTGGACTCGGCAGGATACGCGATCGAAAGGCAGTACGATGCGCTTCTCTTCCACTACTATTGGACCGTGAGA
CTGCCGACCCATTCCCAGCTTCGCCTCGGCATAGCAATGAACGCAAATTGACCGATTGTAGGTCCCCTACTTGGG
CTCAGCACCAGGCGAGGACGGCAAACTCCAGGTGCCCTCGATCCTGGGAACCGGGATAGCGCTGAAGTACTCCTG
GAAATGGAACACGACCGCATCATCGCCCGATATTCGCTATACCCTCGAGGCCATGAACCGGTTCAGCGGCACCGA
GATGGACCCCCTGAACCAGGATCCGGCGCGCGAGCTCCTGCACCGCCTCAAGGCCACGCTTCCGTCCATCGACCT
CACATGGTCCAACCACTTCTTCTCGACCTTGTACGACCACGACCGGTCCAAGTACATGGAGGAGTCCAAGGCCGG
CGCGCGCTTCACGACGACCGTCATGATGGCCGTCGAATTCGTCGAAAAGGGGCCGGTGACGAAGACGTATTTCAT
ACCGCGGAAGCTGGGCCACGGCCACGGCCAGATCCCCATCGCGATGTGGGAGGACAGCCTGGCGCAGCTGGATCC
CCAGAATGCAGCTCGTGGGGCAATGTACGAATTTATGAAGACCGATCCCGAGGGCCGGCTGCTCAGCCCCTTGTA
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail