Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6418
Gene name
LocationContig_33:3599..4250
Strand-
Gene length (bp)651
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11991 Trp_DMAT Tryptophan dimethylallyltransferase 6.0E-36 1 140

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6Q874|SIRD_LEPMC 4-O-dimethylallyl-L-tyrosine synthase OS=Leptosphaeria maculans GN=sirD PE=1 SV=1 1 190 3.0E-32
sp|Q4WYG3|7DMAW_ASPFU 7-dimethylallyltryptophan synthase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=etpPT PE=1 SV=2 1 174 3.0E-14

GO

GO Term Description Terminal node
GO:0009820 alkaloid metabolic process Yes
GO:0016765 transferase activity, transferring alkyl or aryl (other than methyl) groups Yes
GO:1901564 organonitrogen compound metabolic process No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 44 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6418
MLSVDNVAPSQSRLKFYVRTPHTSFSSVRAIMTMGGKIDVAESQLSDLRSLIVAAAGLEPDFPDDAEVPLAPEPN
SGFKTTLAEMPVPLSGYEYYFDIAPGAVVPHIKFYLPLRHYGPDDLTMARGLTSWMETRGRGQYMYGQRYLAMLE
RMSDHRKLGDGKGMHAYLSCIFAKGELDITSCIAPELCVPAASTPPKIVIPRRATRRRGDSPIGMD*
Coding >Hirsu2|6418
ATGCTGTCCGTCGACAACGTTGCACCGTCCCAGTCCCGGCTGAAGTTCTACGTCCGCACGCCGCACACGAGCTTC
TCGTCCGTGAGGGCCATCATGACGATGGGAGGCAAGATTGACGTCGCCGAGTCGCAGCTGAGCGACCTCCGCAGC
CTGATCGTCGCCGCGGCCGGACTGGAGCCCGACTTCCCCGACGACGCCGAAGTTCCGCTCGCACCCGAGCCGAAC
TCCGGCTTCAAGACGACCCTGGCCGAGATGCCCGTGCCGTTGTCCGGGTACGAATACTACTTCGACATCGCCCCC
GGCGCCGTTGTGCCCCATATCAAGTTCTACCTTCCGCTGAGGCACTACGGACCTGACGACCTGACCATGGCACGC
GGCCTCACGAGCTGGATGGAGACCCGCGGCCGCGGCCAGTACATGTACGGCCAGCGCTACCTCGCGATGCTGGAG
CGCATGTCGGACCATCGCAAACTGGGGGACGGGAAGGGAATGCACGCCTATCTGAGCTGCATCTTCGCCAAGGGC
GAGCTCGACATCACGTCGTGTATCGCTCCCGAGCTGTGTGTCCCGGCTGCGTCGACGCCTCCGAAGATTGTCATC
CCACGAAGGGCAACGAGACGGCGTGGAGATAGTCCGATAGGTATGGATTAG
Transcript >Hirsu2|6418
ATGCTGTCCGTCGACAACGTTGCACCGTCCCAGTCCCGGCTGAAGTTCTACGTCCGCACGCCGCACACGAGCTTC
TCGTCCGTGAGGGCCATCATGACGATGGGAGGCAAGATTGACGTCGCCGAGTCGCAGCTGAGCGACCTCCGCAGC
CTGATCGTCGCCGCGGCCGGACTGGAGCCCGACTTCCCCGACGACGCCGAAGTTCCGCTCGCACCCGAGCCGAAC
TCCGGCTTCAAGACGACCCTGGCCGAGATGCCCGTGCCGTTGTCCGGGTACGAATACTACTTCGACATCGCCCCC
GGCGCCGTTGTGCCCCATATCAAGTTCTACCTTCCGCTGAGGCACTACGGACCTGACGACCTGACCATGGCACGC
GGCCTCACGAGCTGGATGGAGACCCGCGGCCGCGGCCAGTACATGTACGGCCAGCGCTACCTCGCGATGCTGGAG
CGCATGTCGGACCATCGCAAACTGGGGGACGGGAAGGGAATGCACGCCTATCTGAGCTGCATCTTCGCCAAGGGC
GAGCTCGACATCACGTCGTGTATCGCTCCCGAGCTGTGTGTCCCGGCTGCGTCGACGCCTCCGAAGATTGTCATC
CCACGAAGGGCAACGAGACGGCGTGGAGATAGTCCGATAGGTATGGATTAG
Gene >Hirsu2|6418
ATGCTGTCCGTCGACAACGTTGCACCGTCCCAGTCCCGGCTGAAGTTCTACGTCCGCACGCCGCACACGAGCTTC
TCGTCCGTGAGGGCCATCATGACGATGGGAGGCAAGATTGACGTCGCCGAGTCGCAGCTGAGCGACCTCCGCAGC
CTGATCGTCGCCGCGGCCGGACTGGAGCCCGACTTCCCCGACGACGCCGAAGTTCCGCTCGCACCCGAGCCGAAC
TCCGGCTTCAAGACGACCCTGGCCGAGATGCCCGTGCCGTTGTCCGGGTACGAATACTACTTCGACATCGCCCCC
GGCGCCGTTGTGCCCCATATCAAGTTCTACCTTCCGCTGAGGCACTACGGACCTGACGACCTGACCATGGCACGC
GGCCTCACGAGCTGGATGGAGACCCGCGGCCGCGGCCAGTACATGTACGGCCAGCGCTACCTCGCGATGCTGGAG
CGCATGTCGGACCATCGCAAACTGGGGGACGGGAAGGGAATGCACGCCTATCTGAGCTGCATCTTCGCCAAGGGC
GAGCTCGACATCACGTCGTGTATCGCTCCCGAGCTGTGTGTCCCGGCTGCGTCGACGCCTCCGAAGATTGTCATC
CCACGAAGGGCAACGAGACGGCGTGGAGATAGTCCGATAGGTATGGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail