Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6409
Gene name
LocationContig_329:13844..16082
Strand+
Gene length (bp)2238
Transcript length (bp)2238
Coding sequence length (bp)2238
Protein length (aa) 746

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02145 Rap_GAP Rap/ran-GAP 9.3E-55 440 643
PF03542 Tuberin Tuberin 3.9E-31 10 191

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc2 PE=1 SV=1 15 648 2.0E-132
sp|P49815|TSC2_HUMAN Tuberin OS=Homo sapiens GN=TSC2 PE=1 SV=2 394 661 3.0E-42
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 375 648 1.0E-40
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 394 648 3.0E-37
sp|Q6GYP7|RGPA1_MOUSE Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus GN=Ralgapa1 PE=1 SV=1 401 617 1.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UUG9|TSC2_SCHPO Tuberous sclerosis 2 protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tsc2 PE=1 SV=1 15 648 2.0E-132
sp|P49815|TSC2_HUMAN Tuberin OS=Homo sapiens GN=TSC2 PE=1 SV=2 394 661 3.0E-42
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 375 648 1.0E-40
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 394 648 3.0E-37
sp|Q6GYP7|RGPA1_MOUSE Ral GTPase-activating protein subunit alpha-1 OS=Mus musculus GN=Ralgapa1 PE=1 SV=1 401 617 1.0E-21
sp|O55007|RGPA1_RAT Ral GTPase-activating protein subunit alpha-1 OS=Rattus norvegicus GN=Ralgapa1 PE=1 SV=2 401 617 1.0E-21
sp|Q6GYQ0|RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens GN=RALGAPA1 PE=1 SV=1 401 617 2.0E-21
sp|A3KGS3|RGPA2_MOUSE Ral GTPase-activating protein subunit alpha-2 OS=Mus musculus GN=Ralgapa2 PE=1 SV=2 409 617 7.0E-20
sp|P86411|RGPA2_RAT Ral GTPase-activating protein subunit alpha-2 OS=Rattus norvegicus GN=Ralgapa2 PE=1 SV=1 409 617 7.0E-20
sp|P49815|TSC2_HUMAN Tuberin OS=Homo sapiens GN=TSC2 PE=1 SV=2 13 265 1.0E-19
sp|Q61037|TSC2_MOUSE Tuberin OS=Mus musculus GN=Tsc2 PE=1 SV=1 13 266 4.0E-19
sp|Q2PPJ7|RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens GN=RALGAPA2 PE=1 SV=2 409 617 5.0E-19
sp|P49816|TSC2_RAT Tuberin OS=Rattus norvegicus GN=Tsc2 PE=1 SV=1 13 265 7.0E-19
sp|Q9VB98|Y5521_DROME Probable Rho GTPase-activating protein CG5521 OS=Drosophila melanogaster GN=CG5521 PE=1 SV=2 409 617 2.0E-17
sp|Q9P2F8|SI1L2_HUMAN Signal-induced proliferation-associated 1-like protein 2 OS=Homo sapiens GN=SIPA1L2 PE=1 SV=2 423 551 2.0E-15
sp|Q55AN8|Y1806_DICDI PH and Rap-GAP domain-containing protein DDB_G0271806 OS=Dictyostelium discoideum GN=DDB_G0271806 PE=3 SV=1 409 621 2.0E-15
sp|Q5JCS6|SI1L2_RAT Signal-induced proliferation-associated 1-like protein 2 OS=Rattus norvegicus GN=Sipa1l2 PE=1 SV=1 423 551 3.0E-15
sp|O60292|SI1L3_HUMAN Signal-induced proliferation-associated 1-like protein 3 OS=Homo sapiens GN=SIPA1L3 PE=1 SV=3 423 551 3.0E-15
sp|P47736|RPGP1_HUMAN Rap1 GTPase-activating protein 1 OS=Homo sapiens GN=RAP1GAP PE=1 SV=2 407 593 4.0E-15
sp|Q80TE4|SI1L2_MOUSE Signal-induced proliferation-associated 1-like protein 2 OS=Mus musculus GN=Sipa1l2 PE=1 SV=3 423 551 4.0E-15
sp|A2ALS5|RPGP1_MOUSE Rap1 GTPase-activating protein 1 OS=Mus musculus GN=Rap1gap PE=1 SV=2 407 593 5.0E-15
sp|Q8C0T5|SI1L1_MOUSE Signal-induced proliferation-associated 1-like protein 1 OS=Mus musculus GN=Sipa1l1 PE=1 SV=2 423 551 3.0E-14
sp|O43166|SI1L1_HUMAN Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens GN=SIPA1L1 PE=1 SV=4 423 551 4.0E-14
sp|O35412|SI1L1_RAT Signal-induced proliferation-associated 1-like protein 1 OS=Rattus norvegicus GN=Sipa1l1 PE=1 SV=1 423 551 4.0E-14
sp|Q96FS4|SIPA1_HUMAN Signal-induced proliferation-associated protein 1 OS=Homo sapiens GN=SIPA1 PE=1 SV=1 424 551 7.0E-14
sp|P46062|SIPA1_MOUSE Signal-induced proliferation-associated protein 1 OS=Mus musculus GN=Sipa1 PE=1 SV=2 424 551 6.0E-13
sp|Q5ZMV8|RPGP2_CHICK Rap1 GTPase-activating protein 2 OS=Gallus gallus GN=RAP1GAP2 PE=2 SV=2 407 551 6.0E-13
sp|Q5ZJY3|GARL3_CHICK GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Gallus gallus GN=GARNL3 PE=2 SV=1 424 530 1.0E-12
sp|Q5VVW2|GARL3_HUMAN GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Homo sapiens GN=GARNL3 PE=2 SV=2 424 530 4.0E-12
sp|Q684P5|RPGP2_HUMAN Rap1 GTPase-activating protein 2 OS=Homo sapiens GN=RAP1GAP2 PE=1 SV=2 407 593 6.0E-12
sp|Q5SVL6|RPGP2_MOUSE Rap1 GTPase-activating protein 2 OS=Mus musculus GN=Rap1gap2 PE=1 SV=1 407 593 1.0E-11
sp|Q3V0G7|GARL3_MOUSE GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Mus musculus GN=Garnl3 PE=1 SV=1 424 530 9.0E-11
sp|A5PF44|GARL3_DANRE GTPase-activating Rap/Ran-GAP domain-like protein 3 OS=Danio rerio GN=garnl3 PE=3 SV=1 424 547 1.0E-10
sp|Q54TK4|Y1809_DICDI Rap-GAP domain-containing protein DDB_G0281809 OS=Dictyostelium discoideum GN=DDB_G0281809 PE=3 SV=1 409 617 2.0E-09
sp|Q75J96|RGAP1_DICDI RapA guanosine triphosphatase-activating protein 1 OS=Dictyostelium discoideum GN=rapgap1 PE=2 SV=1 424 551 3.0E-09
sp|Q54EH3|Y1510_DICDI GTPase-activating protein DDB_G0291510 OS=Dictyostelium discoideum GN=DDB_G0291510 PE=3 SV=1 422 559 3.0E-09
sp|Q54SS8|RGAPB_DICDI RapA guanosine triphosphatase-activating protein B OS=Dictyostelium discoideum GN=rapgapB PE=2 SV=1 424 553 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0051056 regulation of small GTPase mediated signal transduction Yes
GO:0043547 positive regulation of GTPase activity Yes
GO:0005096 GTPase activator activity Yes
GO:0098772 molecular function regulator No
GO:0048583 regulation of response to stimulus No
GO:0009966 regulation of signal transduction No
GO:0003674 molecular_function No
GO:0043087 regulation of GTPase activity No
GO:0023051 regulation of signaling No
GO:0008150 biological_process No
GO:0051345 positive regulation of hydrolase activity No
GO:0050794 regulation of cellular process No
GO:1902531 regulation of intracellular signal transduction No
GO:0008047 enzyme activator activity No
GO:0065007 biological regulation No
GO:0050790 regulation of catalytic activity No
GO:0030234 enzyme regulator activity No
GO:0010646 regulation of cell communication No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0050789 regulation of biological process No
GO:0030695 GTPase regulator activity No
GO:0044093 positive regulation of molecular function No
GO:0065009 regulation of molecular function No
GO:0051336 regulation of hydrolase activity No
GO:0043085 positive regulation of catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6409
MSVWLDAVLAILQGSDWEVCSFVLVHLPSQLSNHAIFRDAIPQIQELRRIICEQIRTNGFQEPPNASGLRRADVA
ICLFHSLTMILSYHEHFQKSDEDDIVKTFALGIAAWERTAKYCIHALSICCHELPLSTSKSLIQLLNQMAAIITQ
PHVSVHILEFLASLSRLHNVFVNFREDDYRIVFGICFRYLEYAKEKKQSNRSSHVSEVSTPGSNHAEPPSTSPAD
ELPQYVHALAYHVILFWFLALKLQDRAHHVGWIVKKLFSDADGHGPAADDQTLTTIDFMQRVTFADVGESAEDPY
FSEDRFGAIVKKQWLLGNSIVTIKQATGSGWAQVIKRQPSGTSAYMVRESFTPTPPHQTAAYVDVSREGQATSDA
ILPSHLLVQLMSPVPQILEEARPIPLPDDEIADRAIRVFDRNSSLDGHKVGVIYIGEGQTQEAEILANVSGSRDY
LEFLNNLGTLTKLKGSTFNTQGLDREYDSDGQYTFCWRDRVTEIVFHVTTQMPTDLERDPNCTLKKRHIGNDFVN
IIFNDSALPFQFETFPSQFNFVNIVITPASRASFVAMRTRGADRGQSQKQPFYRVQVMSKPGFPEVSPASETKMI
SLKALPGFIRLLALNASMFSVVWHNREGGEHISSWSARLREIKRLREKHGPKAATTASSPPASSWHGGASHAQQA
DTSRAGSSVRDSFSSLRRTSVATFFTSTSEQMSHRSSTLSTSATSHDTELPPTAAAANTLVDSVDFSKWA*
Coding >Hirsu2|6409
ATGTCGGTCTGGCTCGATGCTGTCTTGGCAATCCTTCAAGGCAGTGACTGGGAGGTGTGCAGCTTCGTACTTGTC
CATCTCCCGTCGCAGCTCAGCAATCATGCCATCTTCAGAGATGCGATCCCGCAGATTCAGGAACTTCGCAGGATC
ATCTGTGAGCAGATCCGGACAAACGGCTTCCAAGAGCCGCCCAACGCTTCAGGGCTGCGACGAGCGGACGTGGCC
ATCTGTCTCTTCCACAGCTTGACTATGATTCTTAGCTATCACGAGCACTTTCAGAAAAGCGATGAGGATGACATT
GTAAAGACTTTCGCTCTCGGCATCGCCGCGTGGGAACGAACGGCGAAATACTGCATCCATGCGCTCTCTATTTGC
TGCCACGAGCTCCCGCTCTCGACGAGCAAGTCGCTGATCCAGTTGCTGAATCAGATGGCTGCGATCATCACGCAG
CCTCACGTTTCCGTCCACATCCTGGAGTTTCTCGCCTCCTTGAGCCGGCTTCACAACGTCTTTGTCAATTTCCGA
GAGGACGACTACCGGATCGTCTTTGGCATTTGCTTCCGCTACTTGGAGTACGCCAAAGAGAAGAAGCAGTCCAAC
CGCAGCAGCCACGTCAGCGAAGTGTCGACTCCGGGCTCGAACCACGCGGAACCCCCCAGCACGAGCCCTGCCGAT
GAGCTTCCGCAATACGTCCATGCATTGGCCTATCACGTCATATTGTTCTGGTTCCTTGCTTTGAAGCTGCAGGAT
CGGGCACACCACGTAGGGTGGATTGTCAAGAAACTCTTTTCGGATGCAGACGGGCACGGACCGGCGGCTGACGAC
CAGACGCTCACAACGATCGACTTTATGCAAAGGGTCACTTTCGCAGACGTGGGCGAGTCTGCTGAAGACCCCTAC
TTCAGCGAGGATCGCTTCGGCGCCATCGTCAAGAAACAGTGGCTGCTGGGCAACAGCATCGTAACGATCAAGCAG
GCCACAGGGTCCGGGTGGGCTCAAGTTATCAAGAGACAGCCGTCGGGAACGTCGGCGTACATGGTTCGCGAGTCA
TTCACGCCGACTCCGCCGCATCAGACAGCGGCCTACGTCGACGTGAGCCGGGAGGGCCAAGCGACGTCTGATGCC
ATCCTGCCCAGCCACCTGCTGGTCCAGCTCATGTCGCCAGTCCCGCAAATTCTTGAAGAGGCGCGACCGATACCC
CTGCCGGACGATGAGATTGCAGATCGAGCCATCAGAGTTTTTGATCGAAATTCGAGTCTTGATGGCCACAAGGTG
GGCGTCATCTACATTGGCGAGGGCCAGACGCAAGAGGCTGAGATCCTCGCGAACGTCTCCGGCAGCAGGGATTAT
CTCGAGTTTCTCAACAACCTGGGGACGTTGACGAAGCTGAAGGGATCCACGTTCAACACGCAGGGCTTGGACCGT
GAGTACGATTCGGATGGTCAGTACACCTTTTGCTGGCGGGACAGGGTGACGGAGATTGTGTTCCACGTGACGACG
CAGATGCCTACCGACCTGGAGCGAGATCCAAACTGTACACTCAAGAAGAGACACATCGGCAACGACTTCGTCAAC
ATCATCTTCAACGACTCGGCGCTTCCTTTTCAGTTTGAAACGTTCCCAAGTCAATTCAACTTTGTCAACATTGTC
ATCACGCCGGCGTCGCGCGCTTCGTTCGTCGCCATGCGGACGCGGGGTGCGGATCGAGGTCAAAGCCAGAAACAG
CCCTTCTACAGGGTCCAGGTGATGAGCAAGCCGGGTTTTCCGGAGGTGTCCCCGGCGTCGGAGACCAAGATGATA
TCTCTGAAAGCACTCCCGGGCTTCATACGGCTCTTGGCACTCAACGCATCCATGTTTTCGGTAGTGTGGCACAAC
CGGGAGGGAGGCGAGCACATCAGCTCGTGGAGCGCGAGGCTTCGGGAGATTAAACGCCTGCGGGAGAAGCATGGG
CCGAAGGCGGCCACCACGGCCTCGTCGCCGCCGGCTTCATCGTGGCACGGTGGGGCCTCGCACGCTCAACAGGCG
GATACGTCGCGGGCCGGCAGCAGCGTTCGGGATAGTTTCAGCAGCCTGCGTCGGACGAGCGTTGCGACCTTTTTT
ACGAGCACGAGCGAGCAGATGTCTCATCGATCGTCGACACTATCCACGTCGGCTACTTCCCATGATACGGAGCTA
CCGCCGACGGCGGCAGCAGCAAACACTTTGGTGGACTCGGTCGACTTCTCCAAGTGGGCATGA
Transcript >Hirsu2|6409
ATGTCGGTCTGGCTCGATGCTGTCTTGGCAATCCTTCAAGGCAGTGACTGGGAGGTGTGCAGCTTCGTACTTGTC
CATCTCCCGTCGCAGCTCAGCAATCATGCCATCTTCAGAGATGCGATCCCGCAGATTCAGGAACTTCGCAGGATC
ATCTGTGAGCAGATCCGGACAAACGGCTTCCAAGAGCCGCCCAACGCTTCAGGGCTGCGACGAGCGGACGTGGCC
ATCTGTCTCTTCCACAGCTTGACTATGATTCTTAGCTATCACGAGCACTTTCAGAAAAGCGATGAGGATGACATT
GTAAAGACTTTCGCTCTCGGCATCGCCGCGTGGGAACGAACGGCGAAATACTGCATCCATGCGCTCTCTATTTGC
TGCCACGAGCTCCCGCTCTCGACGAGCAAGTCGCTGATCCAGTTGCTGAATCAGATGGCTGCGATCATCACGCAG
CCTCACGTTTCCGTCCACATCCTGGAGTTTCTCGCCTCCTTGAGCCGGCTTCACAACGTCTTTGTCAATTTCCGA
GAGGACGACTACCGGATCGTCTTTGGCATTTGCTTCCGCTACTTGGAGTACGCCAAAGAGAAGAAGCAGTCCAAC
CGCAGCAGCCACGTCAGCGAAGTGTCGACTCCGGGCTCGAACCACGCGGAACCCCCCAGCACGAGCCCTGCCGAT
GAGCTTCCGCAATACGTCCATGCATTGGCCTATCACGTCATATTGTTCTGGTTCCTTGCTTTGAAGCTGCAGGAT
CGGGCACACCACGTAGGGTGGATTGTCAAGAAACTCTTTTCGGATGCAGACGGGCACGGACCGGCGGCTGACGAC
CAGACGCTCACAACGATCGACTTTATGCAAAGGGTCACTTTCGCAGACGTGGGCGAGTCTGCTGAAGACCCCTAC
TTCAGCGAGGATCGCTTCGGCGCCATCGTCAAGAAACAGTGGCTGCTGGGCAACAGCATCGTAACGATCAAGCAG
GCCACAGGGTCCGGGTGGGCTCAAGTTATCAAGAGACAGCCGTCGGGAACGTCGGCGTACATGGTTCGCGAGTCA
TTCACGCCGACTCCGCCGCATCAGACAGCGGCCTACGTCGACGTGAGCCGGGAGGGCCAAGCGACGTCTGATGCC
ATCCTGCCCAGCCACCTGCTGGTCCAGCTCATGTCGCCAGTCCCGCAAATTCTTGAAGAGGCGCGACCGATACCC
CTGCCGGACGATGAGATTGCAGATCGAGCCATCAGAGTTTTTGATCGAAATTCGAGTCTTGATGGCCACAAGGTG
GGCGTCATCTACATTGGCGAGGGCCAGACGCAAGAGGCTGAGATCCTCGCGAACGTCTCCGGCAGCAGGGATTAT
CTCGAGTTTCTCAACAACCTGGGGACGTTGACGAAGCTGAAGGGATCCACGTTCAACACGCAGGGCTTGGACCGT
GAGTACGATTCGGATGGTCAGTACACCTTTTGCTGGCGGGACAGGGTGACGGAGATTGTGTTCCACGTGACGACG
CAGATGCCTACCGACCTGGAGCGAGATCCAAACTGTACACTCAAGAAGAGACACATCGGCAACGACTTCGTCAAC
ATCATCTTCAACGACTCGGCGCTTCCTTTTCAGTTTGAAACGTTCCCAAGTCAATTCAACTTTGTCAACATTGTC
ATCACGCCGGCGTCGCGCGCTTCGTTCGTCGCCATGCGGACGCGGGGTGCGGATCGAGGTCAAAGCCAGAAACAG
CCCTTCTACAGGGTCCAGGTGATGAGCAAGCCGGGTTTTCCGGAGGTGTCCCCGGCGTCGGAGACCAAGATGATA
TCTCTGAAAGCACTCCCGGGCTTCATACGGCTCTTGGCACTCAACGCATCCATGTTTTCGGTAGTGTGGCACAAC
CGGGAGGGAGGCGAGCACATCAGCTCGTGGAGCGCGAGGCTTCGGGAGATTAAACGCCTGCGGGAGAAGCATGGG
CCGAAGGCGGCCACCACGGCCTCGTCGCCGCCGGCTTCATCGTGGCACGGTGGGGCCTCGCACGCTCAACAGGCG
GATACGTCGCGGGCCGGCAGCAGCGTTCGGGATAGTTTCAGCAGCCTGCGTCGGACGAGCGTTGCGACCTTTTTT
ACGAGCACGAGCGAGCAGATGTCTCATCGATCGTCGACACTATCCACGTCGGCTACTTCCCATGATACGGAGCTA
CCGCCGACGGCGGCAGCAGCAAACACTTTGGTGGACTCGGTCGACTTCTCCAAGTGGGCATGA
Gene >Hirsu2|6409
ATGTCGGTCTGGCTCGATGCTGTCTTGGCAATCCTTCAAGGCAGTGACTGGGAGGTGTGCAGCTTCGTACTTGTC
CATCTCCCGTCGCAGCTCAGCAATCATGCCATCTTCAGAGATGCGATCCCGCAGATTCAGGAACTTCGCAGGATC
ATCTGTGAGCAGATCCGGACAAACGGCTTCCAAGAGCCGCCCAACGCTTCAGGGCTGCGACGAGCGGACGTGGCC
ATCTGTCTCTTCCACAGCTTGACTATGATTCTTAGCTATCACGAGCACTTTCAGAAAAGCGATGAGGATGACATT
GTAAAGACTTTCGCTCTCGGCATCGCCGCGTGGGAACGAACGGCGAAATACTGCATCCATGCGCTCTCTATTTGC
TGCCACGAGCTCCCGCTCTCGACGAGCAAGTCGCTGATCCAGTTGCTGAATCAGATGGCTGCGATCATCACGCAG
CCTCACGTTTCCGTCCACATCCTGGAGTTTCTCGCCTCCTTGAGCCGGCTTCACAACGTCTTTGTCAATTTCCGA
GAGGACGACTACCGGATCGTCTTTGGCATTTGCTTCCGCTACTTGGAGTACGCCAAAGAGAAGAAGCAGTCCAAC
CGCAGCAGCCACGTCAGCGAAGTGTCGACTCCGGGCTCGAACCACGCGGAACCCCCCAGCACGAGCCCTGCCGAT
GAGCTTCCGCAATACGTCCATGCATTGGCCTATCACGTCATATTGTTCTGGTTCCTTGCTTTGAAGCTGCAGGAT
CGGGCACACCACGTAGGGTGGATTGTCAAGAAACTCTTTTCGGATGCAGACGGGCACGGACCGGCGGCTGACGAC
CAGACGCTCACAACGATCGACTTTATGCAAAGGGTCACTTTCGCAGACGTGGGCGAGTCTGCTGAAGACCCCTAC
TTCAGCGAGGATCGCTTCGGCGCCATCGTCAAGAAACAGTGGCTGCTGGGCAACAGCATCGTAACGATCAAGCAG
GCCACAGGGTCCGGGTGGGCTCAAGTTATCAAGAGACAGCCGTCGGGAACGTCGGCGTACATGGTTCGCGAGTCA
TTCACGCCGACTCCGCCGCATCAGACAGCGGCCTACGTCGACGTGAGCCGGGAGGGCCAAGCGACGTCTGATGCC
ATCCTGCCCAGCCACCTGCTGGTCCAGCTCATGTCGCCAGTCCCGCAAATTCTTGAAGAGGCGCGACCGATACCC
CTGCCGGACGATGAGATTGCAGATCGAGCCATCAGAGTTTTTGATCGAAATTCGAGTCTTGATGGCCACAAGGTG
GGCGTCATCTACATTGGCGAGGGCCAGACGCAAGAGGCTGAGATCCTCGCGAACGTCTCCGGCAGCAGGGATTAT
CTCGAGTTTCTCAACAACCTGGGGACGTTGACGAAGCTGAAGGGATCCACGTTCAACACGCAGGGCTTGGACCGT
GAGTACGATTCGGATGGTCAGTACACCTTTTGCTGGCGGGACAGGGTGACGGAGATTGTGTTCCACGTGACGACG
CAGATGCCTACCGACCTGGAGCGAGATCCAAACTGTACACTCAAGAAGAGACACATCGGCAACGACTTCGTCAAC
ATCATCTTCAACGACTCGGCGCTTCCTTTTCAGTTTGAAACGTTCCCAAGTCAATTCAACTTTGTCAACATTGTC
ATCACGCCGGCGTCGCGCGCTTCGTTCGTCGCCATGCGGACGCGGGGTGCGGATCGAGGTCAAAGCCAGAAACAG
CCCTTCTACAGGGTCCAGGTGATGAGCAAGCCGGGTTTTCCGGAGGTGTCCCCGGCGTCGGAGACCAAGATGATA
TCTCTGAAAGCACTCCCGGGCTTCATACGGCTCTTGGCACTCAACGCATCCATGTTTTCGGTAGTGTGGCACAAC
CGGGAGGGAGGCGAGCACATCAGCTCGTGGAGCGCGAGGCTTCGGGAGATTAAACGCCTGCGGGAGAAGCATGGG
CCGAAGGCGGCCACCACGGCCTCGTCGCCGCCGGCTTCATCGTGGCACGGTGGGGCCTCGCACGCTCAACAGGCG
GATACGTCGCGGGCCGGCAGCAGCGTTCGGGATAGTTTCAGCAGCCTGCGTCGGACGAGCGTTGCGACCTTTTTT
ACGAGCACGAGCGAGCAGATGTCTCATCGATCGTCGACACTATCCACGTCGGCTACTTCCCATGATACGGAGCTA
CCGCCGACGGCGGCAGCAGCAAACACTTTGGTGGACTCGGTCGACTTCTCCAAGTGGGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail