Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6404
Gene name
LocationContig_3285:83..1074
Strand-
Gene length (bp)991
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16212 PhoLip_ATPase_C Phospholipid-translocating P-type ATPase C-terminal 5.9E-54 7 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 7 280 1.0E-108
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 7 285 2.0E-108
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 7 274 3.0E-42
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 7 274 8.0E-42
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 7 274 9.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 7 280 1.0E-108
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 7 285 2.0E-108
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 7 274 3.0E-42
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 7 274 8.0E-42
sp|Q29449|AT8A1_BOVIN Probable phospholipid-transporting ATPase IA OS=Bos taurus GN=ATP8A1 PE=1 SV=2 7 274 9.0E-41
sp|P98200|AT8A2_MOUSE Phospholipid-transporting ATPase IB OS=Mus musculus GN=Atp8a2 PE=1 SV=1 7 276 2.0E-37
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 7 276 2.0E-37
sp|Q9NTI2|AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens GN=ATP8A2 PE=1 SV=2 7 276 2.0E-37
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 7 238 8.0E-32
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 7 256 4.0E-30
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 7 238 9.0E-30
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 13 241 4.0E-28
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 7 238 8.0E-27
sp|Q9SGG3|ALA5_ARATH Probable phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana GN=ALA5 PE=3 SV=1 13 241 5.0E-26
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 13 273 5.0E-26
sp|Q9LVK9|ALA7_ARATH Probable phospholipid-transporting ATPase 7 OS=Arabidopsis thaliana GN=ALA7 PE=3 SV=3 13 251 7.0E-26
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 13 215 2.0E-25
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 7 216 3.0E-24
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 14 274 9.0E-24
sp|O43520|AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens GN=ATP8B1 PE=1 SV=3 7 253 1.0E-23
sp|Q148W0|AT8B1_MOUSE Phospholipid-transporting ATPase IC OS=Mus musculus GN=Atp8b1 PE=1 SV=2 7 253 2.0E-23
sp|P98197|AT11A_MOUSE Probable phospholipid-transporting ATPase IH OS=Mus musculus GN=Atp11a PE=1 SV=1 7 283 6.0E-22
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 7 216 1.0E-21
sp|Q5BL50|AT8B1_XENTR Phospholipid-transporting ATPase IC OS=Xenopus tropicalis GN=atp8b1 PE=2 SV=1 7 253 2.0E-21
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 7 216 7.0E-21
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 13 258 2.0E-18
sp|O94823|AT10B_HUMAN Probable phospholipid-transporting ATPase VB OS=Homo sapiens GN=ATP10B PE=2 SV=2 7 195 2.0E-18
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 7 216 3.0E-18
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 13 258 3.0E-17
sp|Q9QZW0|AT11C_MOUSE Phospholipid-transporting ATPase 11C OS=Mus musculus GN=Atp11c PE=1 SV=2 7 195 4.0E-17
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 7 195 4.0E-17
sp|A3FIN4|AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus GN=Atp8b5 PE=2 SV=1 7 209 5.0E-17
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 7 209 2.0E-16
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 7 263 2.0E-16
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 13 220 1.0E-15
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 13 195 2.0E-14
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 7 231 3.0E-14
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 7 236 4.0E-14
sp|P32660|ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF1 PE=1 SV=2 7 228 6.0E-14
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 7 206 2.0E-13
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 11 151 6.0E-13
sp|Q6UQ17|AT8B3_MOUSE Phospholipid-transporting ATPase IK OS=Mus musculus GN=Atp8b3 PE=1 SV=1 7 159 1.0E-11
sp|Q12675|ATC4_YEAST Phospholipid-transporting ATPase DNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF2 PE=1 SV=1 7 234 2.0E-11
sp|Q9UT43|YFRD_SCHPO Putative phospholipid-transporting ATPase C821.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC821.13c PE=1 SV=2 13 250 1.0E-10
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 7 210 7.0E-10
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 7 220 1.0E-09
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 7 217 1.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.5

Transmembrane Domains

Domain # Start End Length
1 29 51 22
2 71 93 22
3 108 130 22
4 137 159 22
5 181 200 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6404
LTRGAQYTFQNVFSGQVIYESWTLSFYNVFYTVLPPLALGILDQFISARLLDRYPQLYMMGQNNYFFRLKVFAEW
IANAFYHSLVLYAATQLIWYGDLIQGDGKTAGHWVWGTALYGAVLLTVLGKAALVTSNWTKYHVLAIPGSMAVWY
VFIAAYGSLGPMAGLSTEYRGVVPRLYTSPIFWLQTMTLAMLCLLRDFAWKYAKRMYWPQTYHHIQEIQKYNIQD
YRPRMEQFQKAIRKVRQVQRMRKQRGYAFSQADESQTRVLQAYDTTKHRGRYGEMASSRPTGGTK*
Coding >Hirsu2|6404
CTGACGCGAGGCGCGCAGTACACGTTCCAGAACGTCTTCTCCGGGCAGGTCATCTACGAGTCGTGGACGCTGTCG
TTCTACAACGTCTTCTACACGGTGCTGCCGCCGCTGGCGCTCGGGATCCTGGACCAGTTCATCTCGGCGCGGCTG
CTGGACCGGTACCCGCAGCTGTACATGATGGGCCAGAACAACTACTTCTTCCGGCTCAAGGTGTTCGCCGAGTGG
ATCGCCAACGCCTTCTACCACTCGCTGGTGCTGTACGCGGCGACGCAGCTGATCTGGTACGGCGACCTGATCCAG
GGCGACGGCAAGACGGCCGGGCACTGGGTGTGGGGGACGGCGCTGTACGGGGCGGTGCTGCTGACGGTGCTGGGC
AAGGCGGCGCTGGTGACGAGCAACTGGACCAAGTACCACGTGCTGGCGATACCGGGCAGCATGGCGGTCTGGTAC
GTCTTCATCGCGGCCTACGGGTCGCTGGGGCCCATGGCCGGGCTGTCGACCGAGTACCGCGGCGTGGTGCCGCGC
CTGTACACGAGCCCCATCTTCTGGCTGCAGACGATGACGCTGGCGATGCTGTGCCTGCTGCGCGACTTCGCCTGG
AAGTACGCCAAGCGCATGTACTGGCCGCAGACGTACCACCACATCCAGGAGATCCAGAAGTACAACATCCAAGAC
TACCGACCGAGAATGGAGCAGTTCCAGAAGGCGATCCGCAAGGTGCGGCAGGTCCAGCGGATGCGTAAGCAGCGC
GGCTACGCCTTCTCGCAGGCGGACGAGAGCCAGACGCGCGTGCTGCAGGCCTACGACACGACCAAGCACCGCGGG
CGGTACGGCGAGATGGCCAGCTCGCGCCCGACGGGCGGCACCAAGTGA
Transcript >Hirsu2|6404
CTGACGCGAGGCGCGCAGTACACGTTCCAGAACGTCTTCTCCGGGCAGGTCATCTACGAGTCGTGGACGCTGTCG
TTCTACAACGTCTTCTACACGGTGCTGCCGCCGCTGGCGCTCGGGATCCTGGACCAGTTCATCTCGGCGCGGCTG
CTGGACCGGTACCCGCAGCTGTACATGATGGGCCAGAACAACTACTTCTTCCGGCTCAAGGTGTTCGCCGAGTGG
ATCGCCAACGCCTTCTACCACTCGCTGGTGCTGTACGCGGCGACGCAGCTGATCTGGTACGGCGACCTGATCCAG
GGCGACGGCAAGACGGCCGGGCACTGGGTGTGGGGGACGGCGCTGTACGGGGCGGTGCTGCTGACGGTGCTGGGC
AAGGCGGCGCTGGTGACGAGCAACTGGACCAAGTACCACGTGCTGGCGATACCGGGCAGCATGGCGGTCTGGTAC
GTCTTCATCGCGGCCTACGGGTCGCTGGGGCCCATGGCCGGGCTGTCGACCGAGTACCGCGGCGTGGTGCCGCGC
CTGTACACGAGCCCCATCTTCTGGCTGCAGACGATGACGCTGGCGATGCTGTGCCTGCTGCGCGACTTCGCCTGG
AAGTACGCCAAGCGCATGTACTGGCCGCAGACGTACCACCACATCCAGGAGATCCAGAAGTACAACATCCAAGAC
TACCGACCGAGAATGGAGCAGTTCCAGAAGGCGATCCGCAAGGTGCGGCAGGTCCAGCGGATGCGTAAGCAGCGC
GGCTACGCCTTCTCGCAGGCGGACGAGAGCCAGACGCGCGTGCTGCAGGCCTACGACACGACCAAGCACCGCGGG
CGGTACGGCGAGATGGCCAGCTCGCGCCCGACGGGCGGCACCAAGTGA
Gene >Hirsu2|6404
CTGACGCGAGGCGCGCAGTACACGTTCCAGAACGTCTTCTCCGGGCAGGTCATCTACGAGTCGTGGACGCTGTCG
TTCTACAACGTCTTCTACACGGTGCTGCCGCCGCTGGCGCTCGGGATCCTGGACCAGTTCATCTCGGCGCGGCTG
CTGGACCGGTACCCGCAGCTGTACATGATGGGCCAGAACAACTACTTCTTCCGGCTCAAGGTGTTCGCCGAGTGG
ATCGCCAACGCCTTCTACCACTCGCTGGTGCTGTACGCGGCGACGCAGCTGATCTGGTACGGCGACCTGATCCAG
GGCGACGGCAAGACGGCCGGGCACTGGGTGTGGGGGACGGCGCTGTACGGGGCGGTGCTGCTGACGGTGCTGGGC
AAGGCGGCGCTGGTGACGAGCAACTGGACCAAGTACCACGTGCTGGCGATACCGGGCAGCATGGCGGTCTGGTAC
GTCTTCATCGCGGCCTACGGGTCGCTGGGGCCCATGGCCGGGCTGTCGACCGAGTACCGCGGCGTGGTGCCGCGC
CTGTACACGAGCCCCATCTTCTGGCTGCAGACGATGACGCTGGCGATGCTGTGCCTGCTGCGCGACTTCGCCTGG
AAGTACGCCAAGCGCATGTACTGGCCGCAGACGTACCACCACATCCAGGAGATCCAGAAGTACAACATCCAAGAC
TACCGACCGAGGTGAGCAGCCGTCTGTTTCTCTTTCGTTCCCGCCCCCCCTCGCGGGGCCGTCCCGTCGGAGAGA
AAGGGGCGGCACCCGCAGGCAGGATAGGATCTCCGCTGACGTTGGGCTTCGCAGAATGGAGCAGTTCCAGAAGGC
GATCCGCAAGGTGCGGCAGGTCCAGCGGATGCGTAAGCAGCGCGGCTACGCCTTCTCGCAGGCGGACGAGAGCCA
GACGCGCGTGCTGCAGGCCTACGACACGACCAAGCACCGCGGGCGGTACGGCGAGATGGCCAGCTCGCGCCCGAC
GGGCGGCACCAAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail