Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6403
Gene name
LocationContig_3284:635..1008
Strand-
Gene length (bp)373
Transcript length (bp)318
Coding sequence length (bp)318
Protein length (aa) 106

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04508 Pox_A_type_inc Viral A-type inclusion protein repeat 6.0E-05 58 72

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016032 viral process Yes
GO:0008150 biological_process No
GO:0051704 multi-organism process No
GO:0044419 interspecies interaction between organisms No
GO:0044403 symbiont process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6403
MARADLHGRSRTPSRGASPRLRAASISADSGDLVLGGRDESAFYQAETQMLVRENQMLRLRIRDLEKQLAECSPG
PAGATEPPIPSQLTRSSTTADDADDADKEP*
Coding >Hirsu2|6403
ATGGCCCGCGCCGACCTGCACGGCCGCTCGCGCACCCCCAGCCGCGGCGCCTCGCCGCGCCTGCGCGCCGCCTCC
ATCAGCGCCGACTCCGGCGACCTCGTCCTCGGCGGCCGCGACGAGAGCGCCTTCTACCAGGCCGAGACGCAGATG
CTGGTGCGCGAGAACCAGATGCTGCGCCTCCGCATCCGCGACCTCGAGAAGCAGCTGGCCGAGTGCTCGCCCGGC
CCGGCCGGCGCGACGGAGCCGCCCATCCCGTCGCAGCTGACGCGCTCGTCGACGACGGCCGACGACGCCGACGAC
GCCGACAAGGAACCCTAG
Transcript >Hirsu2|6403
ATGGCCCGCGCCGACCTGCACGGCCGCTCGCGCACCCCCAGCCGCGGCGCCTCGCCGCGCCTGCGCGCCGCCTCC
ATCAGCGCCGACTCCGGCGACCTCGTCCTCGGCGGCCGCGACGAGAGCGCCTTCTACCAGGCCGAGACGCAGATG
CTGGTGCGCGAGAACCAGATGCTGCGCCTCCGCATCCGCGACCTCGAGAAGCAGCTGGCCGAGTGCTCGCCCGGC
CCGGCCGGCGCGACGGAGCCGCCCATCCCGTCGCAGCTGACGCGCTCGTCGACGACGGCCGACGACGCCGACGAC
GCCGACAAGGAACCCTAG
Gene >Hirsu2|6403
ATGGCCCGCGCCGACCTGCACGGCCGCTCGCGCACCCCCAGCCGCGGCGCCTCGCCGCGCCTGCGCGCCGCCTCC
ATCAGCGCCGACTCCGGCGACCTCGTCCTCGGCGGCCGCGACGAGAGCGCCTTCTACCAGGCCGAGACGCAGATG
CTGGTGCGCGAGAACCAGATGCTGCGCCTCCGCATCCGCGACCTCGGTAATTCTCCCCCCCCATTCTCTTTCCGC
TCCGCTCCCGCTGACGCCCCGCGCAGAGAAGCAGCTGGCCGAGTGCTCGCCCGGCCCGGCCGGCGCGACGGAGCC
GCCCATCCCGTCGCAGCTGACGCGCTCGTCGACGACGGCCGACGACGCCGACGACGCCGACAAGGAACCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail