Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6394
Gene name
LocationContig_3277:791..1091
Strand+
Gene length (bp)300
Transcript length (bp)300
Coding sequence length (bp)300
Protein length (aa) 100

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09801 SYS1 Integral membrane protein S linking to the trans Golgi network 1.7E-17 12 89

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P41544|SYS1_YEAST Protein SYS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYS1 PE=1 SV=1 1 98 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 30 49 19
2 69 91 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6394
MPRRRRPPRAGALSELQPVKIAGQMAALQALFYAAALVLMLFTALVAGMPFRLDLVLGWEGVRGDTTRGWLLAFV
WLLDGGLCMCVPLLIAPCGPGRLN*
Coding >Hirsu2|6394
ATGCCGCGACGACGCCGGCCGCCGCGCGCGGGCGCCCTGTCGGAGCTGCAGCCGGTCAAGATCGCGGGCCAGATG
GCGGCGCTGCAGGCGCTCTTCTACGCGGCCGCGCTCGTCCTCATGCTCTTCACCGCGCTCGTCGCCGGCATGCCC
TTCCGTCTTGACCTGGTGCTCGGCTGGGAGGGCGTGCGGGGCGACACGACGCGCGGCTGGCTGCTGGCCTTTGTC
TGGCTGCTCGACGGCGGCCTCTGCATGTGCGTTCCTCTCCTCATCGCTCCGTGCGGACCTGGTCGTCTGAATTGA
Transcript >Hirsu2|6394
ATGCCGCGACGACGCCGGCCGCCGCGCGCGGGCGCCCTGTCGGAGCTGCAGCCGGTCAAGATCGCGGGCCAGATG
GCGGCGCTGCAGGCGCTCTTCTACGCGGCCGCGCTCGTCCTCATGCTCTTCACCGCGCTCGTCGCCGGCATGCCC
TTCCGTCTTGACCTGGTGCTCGGCTGGGAGGGCGTGCGGGGCGACACGACGCGCGGCTGGCTGCTGGCCTTTGTC
TGGCTGCTCGACGGCGGCCTCTGCATGTGCGTTCCTCTCCTCATCGCTCCGTGCGGACCTGGTCGTCTGAATTGA
Gene >Hirsu2|6394
ATGCCGCGACGACGCCGGCCGCCGCGCGCGGGCGCCCTGTCGGAGCTGCAGCCGGTCAAGATCGCGGGCCAGATG
GCGGCGCTGCAGGCGCTCTTCTACGCGGCCGCGCTCGTCCTCATGCTCTTCACCGCGCTCGTCGCCGGCATGCCC
TTCCGTCTTGACCTGGTGCTCGGCTGGGAGGGCGTGCGGGGCGACACGACGCGCGGCTGGCTGCTGGCCTTTGTC
TGGCTGCTCGACGGCGGCCTCTGCATGTGCGTTCCTCTCCTCATCGCTCCGTGCGGACCTGGTCGTCTGAATTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail