Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6375
Gene name
LocationContig_3258:429..1046
Strand-
Gene length (bp)617
Transcript length (bp)336
Coding sequence length (bp)336
Protein length (aa) 112

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05002 SGS SGS domain 2.1E-25 47 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08446|SGT1_YEAST Protein SGT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT1 PE=1 SV=1 8 109 6.0E-18
sp|Q9SUR9|SGT1A_ARATH Protein SGT1 homolog A OS=Arabidopsis thaliana GN=SGT1A PE=1 SV=1 53 110 5.0E-15
sp|Q0JL44|SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica GN=SGT1 PE=1 SV=1 53 110 7.0E-13
sp|Q9SUT5|SGT1B_ARATH Protein SGT1 homolog B OS=Arabidopsis thaliana GN=SGT1B PE=1 SV=1 45 110 7.0E-13
sp|O59709|GIT7_SCHPO Glucose-insensitive transcription protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git7 PE=3 SV=2 33 107 1.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08446|SGT1_YEAST Protein SGT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGT1 PE=1 SV=1 8 109 6.0E-18
sp|Q9SUR9|SGT1A_ARATH Protein SGT1 homolog A OS=Arabidopsis thaliana GN=SGT1A PE=1 SV=1 53 110 5.0E-15
sp|Q0JL44|SGT1_ORYSJ Protein SGT1 homolog OS=Oryza sativa subsp. japonica GN=SGT1 PE=1 SV=1 53 110 7.0E-13
sp|Q9SUT5|SGT1B_ARATH Protein SGT1 homolog B OS=Arabidopsis thaliana GN=SGT1B PE=1 SV=1 45 110 7.0E-13
sp|O59709|GIT7_SCHPO Glucose-insensitive transcription protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=git7 PE=3 SV=2 33 107 1.0E-12
sp|Q55ED0|SGT1_DICDI Protein SGT1 homolog OS=Dictyostelium discoideum GN=sugt1 PE=2 SV=1 17 111 4.0E-10
sp|B0BN85|SGT1_RAT Protein SGT1 homolog OS=Rattus norvegicus GN=Sugt1 PE=2 SV=1 53 102 2.0E-09
sp|Q2KIK0|SGT1_BOVIN Protein SGT1 homolog OS=Bos taurus GN=SUGT1 PE=2 SV=1 53 102 2.0E-09
sp|Q9CX34|SGT1_MOUSE Protein SGT1 homolog OS=Mus musculus GN=Sugt1 PE=1 SV=3 53 102 2.0E-09
sp|Q9Y2Z0|SGT1_HUMAN Protein SGT1 homolog OS=Homo sapiens GN=SUGT1 PE=1 SV=3 53 102 2.0E-09
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6375
MTVSIFSKGNDRDKLLVGLFPQAISIESVNYPDGRKRTLRLELWDEIDEAGDVNLFFKRLYRNATAEQQRAMTKS
FTESNGTSLSTDWGDVKDRTVETVPPDGVVAKPWEK*
Coding >Hirsu2|6375
ATGACCGTCTCCATCTTCTCCAAGGGCAACGACCGGGATAAGCTCTTGGTCGGATTGTTCCCGCAGGCCATCTCC
ATCGAATCCGTCAACTACCCGGACGGGCGCAAGAGGACGCTGCGCCTCGAGCTCTGGGACGAGATCGACGAGGCC
GGCGACGTCAACCTCTTCTTCAAGCGGCTCTACCGCAATGCGACGGCCGAGCAGCAGCGCGCCATGACCAAGAGC
TTCACCGAGAGCAACGGCACCTCGCTCAGCACCGACTGGGGCGACGTCAAGGACCGTACCGTCGAGACGGTCCCG
CCCGACGGCGTCGTGGCCAAGCCGTGGGAAAAATGA
Transcript >Hirsu2|6375
ATGACCGTCTCCATCTTCTCCAAGGGCAACGACCGGGATAAGCTCTTGGTCGGATTGTTCCCGCAGGCCATCTCC
ATCGAATCCGTCAACTACCCGGACGGGCGCAAGAGGACGCTGCGCCTCGAGCTCTGGGACGAGATCGACGAGGCC
GGCGACGTCAACCTCTTCTTCAAGCGGCTCTACCGCAATGCGACGGCCGAGCAGCAGCGCGCCATGACCAAGAGC
TTCACCGAGAGCAACGGCACCTCGCTCAGCACCGACTGGGGCGACGTCAAGGACCGTACCGTCGAGACGGTCCCG
CCCGACGGCGTCGTGGCCAAGCCGTGGGAAAAATGA
Gene >Hirsu2|6375
ATGACCGTCTCCATCTTCTCCAAGGGCAACGACCGGGATAAGCTCTTGGTCGGATTGTTCCCGCAGGCCATCTCC
ATCGAATCCGTCAACTACCCGGACGGGCGCAAGAGGACGCTGCGCCTCGAGCTCTGGGACGAGATCGTGCCGTCC
ATCTCGCGCTACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGACGAGGACGAGGCCGGCGACGTCAACCTCTTCT
TCAAGCGGCTCTACCGCAATGCGACGGCCGAGCAGCAGCGCGCCATGACCAAGAGCTTCACCGAGAGCAACGGCA
CCTCGCTCAGCACCGACTGGGGCGACGTCAAGGACCGTACCGTCGAGACGGTCCCGCCCGACGGCGTCGTGGCCA
AGCCGTGGGAAAAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail