Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6373
Gene name
LocationContig_3255:220..1031
Strand+
Gene length (bp)811
Transcript length (bp)711
Coding sequence length (bp)711
Protein length (aa) 237

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01018 GTP1_OBG GTP1/OBG 6.0E-22 2 80

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0D3S3|OBGC1_ORYSJ Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. japonica GN=OBGC1 PE=3 SV=1 2 74 6.0E-08
sp|A2YPR8|OBGC1_ORYSI Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. indica GN=OBGC1 PE=3 SV=1 2 74 6.0E-08
sp|P0CB41|OBG_CAUCR GTPase Obg OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=obg PE=3 SV=1 22 84 7.0E-08
sp|B8GYI7|OBG_CAUCN GTPase Obg/CgtA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cgtA PE=1 SV=1 22 84 7.0E-08
sp|Q0BZ39|OBG_HYPNA GTPase Obg OS=Hyphomonas neptunium (strain ATCC 15444) GN=obg PE=3 SV=1 22 87 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0D3S3|OBGC1_ORYSJ Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. japonica GN=OBGC1 PE=3 SV=1 2 74 6.0E-08
sp|A2YPR8|OBGC1_ORYSI Probable GTP-binding protein OBGC1, chloroplastic OS=Oryza sativa subsp. indica GN=OBGC1 PE=3 SV=1 2 74 6.0E-08
sp|P0CB41|OBG_CAUCR GTPase Obg OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=obg PE=3 SV=1 22 84 7.0E-08
sp|B8GYI7|OBG_CAUCN GTPase Obg/CgtA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cgtA PE=1 SV=1 22 84 7.0E-08
sp|Q0BZ39|OBG_HYPNA GTPase Obg OS=Hyphomonas neptunium (strain ATCC 15444) GN=obg PE=3 SV=1 22 87 1.0E-07
sp|C1A1L5|OBG_RHOE4 GTPase Obg OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=obg PE=3 SV=1 2 77 2.0E-07
sp|A0LPF9|OBG_SYNFM GTPase Obg OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=obg PE=3 SV=1 2 84 4.0E-07
sp|B0T310|OBG_CAUSK GTPase Obg OS=Caulobacter sp. (strain K31) GN=obg PE=3 SV=1 22 84 1.0E-06
sp|B4RD64|OBG_PHEZH GTPase Obg OS=Phenylobacterium zucineum (strain HLK1) GN=obg PE=3 SV=1 22 79 2.0E-06
sp|Q8L7L0|OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana GN=OBGL PE=2 SV=1 2 75 2.0E-06
sp|Q1AVU3|OBG_RUBXD GTPase Obg OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=obg PE=3 SV=1 21 73 4.0E-06
sp|B6IQZ9|OBG_RHOCS GTPase Obg OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=obg PE=3 SV=1 21 73 4.0E-06
sp|Q7CW97|OBG_AGRFC GTPase Obg OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=obg PE=3 SV=2 22 87 6.0E-06
sp|Q1LSJ9|OBG_BAUCH GTPase Obg OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=obg PE=3 SV=1 2 73 8.0E-06
sp|Q11CP6|OBG_CHESB GTPase Obg OS=Chelativorans sp. (strain BNC1) GN=obg PE=3 SV=1 22 87 8.0E-06
sp|B3E609|OBG_GEOLS GTPase Obg OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=obg PE=3 SV=1 2 84 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion 0.381 0.35 0.2587 0.0104 0.6184 0.1267 0.1859 0.0756 0.0915 0.0079

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3404
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3648
Ophiocordyceps australis map64 (Brazil) OphauB2|1245
Ophiocordyceps camponoti-floridani Ophcf2|02743
Ophiocordyceps camponoti-rufipedis Ophun1|1563
Ophiocordyceps kimflemingae Ophio5|244
Ophiocordyceps subramaniannii Hirsu2|6373 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6373
LRDAYLPDGPPNGGDGGTGGNVYIQAAHGETSLHKLARQHFVRAGRGKHGQGRARGGARGEDVVITVPVGTVVRE
IERHDPAAEDLANFRAWRQLVKQRKRDKRLRLEAAAAAAAAAEAEADVDSSPSHDAKPQARPPPTPPEDDDDEHE
FQLRDPSRQKWVLYPGMSKSELNSAAMPRLHPRSRLLQQPAAPIALDLTRPTPRPILLAVGGVGGLGNPHFTSRE
HPRPIAPSSAP*
Coding >Hirsu2|6373
CTGCGCGACGCCTACCTCCCCGACGGGCCCCCCAACGGCGGCGACGGCGGCACCGGCGGTAACGTCTACATCCAG
GCCGCCCACGGCGAGACGTCTCTCCACAAGCTCGCCCGCCAGCACTTCGTCCGCGCCGGCCGCGGCAAGCACGGC
CAGGGCAGGGCCCGCGGCGGCGCCCGCGGCGAAGACGTCGTCATCACCGTCCCCGTCGGTACTGTCGTCCGCGAG
ATCGAGAGGCACGACCCCGCCGCCGAGGACCTCGCCAACTTCCGAGCCTGGAGGCAGCTCGTCAAGCAGAGGAAG
AGGGACAAGCGGCTTCGCCTCGAGGCCGCCGCCGCCGCCGCCGCCGCCGCCGAGGCCGAGGCAGACGTCGACTCT
TCTCCTTCGCACGACGCGAAACCCCAGGCCCGGCCGCCGCCGACGCCGCCCGAAGACGACGACGATGAGCACGAG
TTCCAGCTCCGAGACCCGTCGCGCCAGAAATGGGTCCTCTACCCGGGCATGTCCAAGTCCGAGCTCAACAGCGCC
GCCATGCCGCGCCTGCATCCGCGCAGCCGCCTCCTCCAGCAGCCTGCCGCGCCCATCGCCCTCGACCTGACGCGC
CCGACACCCAGGCCCATCCTCCTCGCCGTCGGCGGCGTCGGCGGCCTGGGCAACCCGCACTTCACCTCGAGGGAA
CACCCGCGCCCCATAGCACCCTCCTCCGCGCCATGA
Transcript >Hirsu2|6373
CTGCGCGACGCCTACCTCCCCGACGGGCCCCCCAACGGCGGCGACGGCGGCACCGGCGGTAACGTCTACATCCAG
GCCGCCCACGGCGAGACGTCTCTCCACAAGCTCGCCCGCCAGCACTTCGTCCGCGCCGGCCGCGGCAAGCACGGC
CAGGGCAGGGCCCGCGGCGGCGCCCGCGGCGAAGACGTCGTCATCACCGTCCCCGTCGGTACTGTCGTCCGCGAG
ATCGAGAGGCACGACCCCGCCGCCGAGGACCTCGCCAACTTCCGAGCCTGGAGGCAGCTCGTCAAGCAGAGGAAG
AGGGACAAGCGGCTTCGCCTCGAGGCCGCCGCCGCCGCCGCCGCCGCCGCCGAGGCCGAGGCAGACGTCGACTCT
TCTCCTTCGCACGACGCGAAACCCCAGGCCCGGCCGCCGCCGACGCCGCCCGAAGACGACGACGATGAGCACGAG
TTCCAGCTCCGAGACCCGTCGCGCCAGAAATGGGTCCTCTACCCGGGCATGTCCAAGTCCGAGCTCAACAGCGCC
GCCATGCCGCGCCTGCATCCGCGCAGCCGCCTCCTCCAGCAGCCTGCCGCGCCCATCGCCCTCGACCTGACGCGC
CCGACACCCAGGCCCATCCTCCTCGCCGTCGGCGGCGTCGGCGGCCTGGGCAACCCGCACTTCACCTCGAGGGAA
CACCCGCGCCCCATAGCACCCTCCTCCGCGCCATGA
Gene >Hirsu2|6373
CTGCGCGACGCCTACCTCCCCGACGGGCCCCCCAACGGCGGCGACGGCGGCACCGGCGGTAACGTCTACATCCAG
GCCGCCCACGGCGAGACGTCTCTCCACAAGCTCGCCCGCCAGCACTTCGTCCGCGCCGGCCGCGGCAAGCACGGC
CAGGGCAGGGCCCGCGGCGGCGCCCGCGGCGAAGACGTCGTCATCACCGTCCCCGTCGGTACTGTCGTCCGCGAG
ATCGAGAGGCACGACCCCGCCGCCGAGGACCTCGCCAACTTCCGAGCCTGGAGGCAGCTCGTCAAGCAGAGGAAG
AGGGACAAGCGGCTTCGCCTCGAGGCCGCCGCCGCCGCCGCCGCCGCCGCCGAGGCCGAGGCAGACGTCGACTCT
TCTCCTTCGCACGACGCGAAACCCCAGGCCCGGCCGCCGCCGACGCCGCCCGAAGACGACGACGATGAGCACGAG
TTCCAGCTCCGAGACCCGTCGCGCCAGAAATGGGTCCTCTACCCGGGCATGTCCAAGTCCGAGCTCAACAGCGCC
GCCATGCCGCGCCTGCATCCGCGCAGCCGCCTCCTCCAGCAGCCTGCCGCGCCCATCGCCCTCGACCTGACGCGC
CCGACACCCAGGCCCATCCTCCTCGCCGTCGGCGGCGTCGGCGGCCTGGGCAACCCGCACTTCACCTCGAGGGAA
CACCCGCGCCCCATGTTCGCCACCAAGGGCGAGGCCGCCGTCAGCCTCAAGATCTCGCTCGAGCTCAAGCTGCTG
GCCGACGTCGGCCTCGTCGGCCTGCCCAACGCCGGCAAGAGCACCCTCCTCCGCGCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail