Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|637
Gene name
LocationContig_1128:2132..3117
Strand+
Gene length (bp)985
Transcript length (bp)912
Coding sequence length (bp)912
Protein length (aa) 304

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 2.9E-27 48 303

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWR1|JMJ30_ARATH Putative lysine-specific demethylase JMJD5 OS=Arabidopsis thaliana GN=JMJD5 PE=2 SV=1 127 302 2.0E-11
sp|Q55DF5|JMJCD_DICDI JmjC domain-containing protein D OS=Dictyostelium discoideum GN=jcdD PE=3 SV=1 146 287 1.0E-09
sp|Q54FG7|JMJCF_DICDI JmjC domain-containing protein F OS=Dictyostelium discoideum GN=jcdF PE=3 SV=1 146 286 4.0E-09
sp|B2GUS6|KDM8_XENTR Lysine-specific demethylase 8 OS=Xenopus tropicalis GN=kdm8 PE=2 SV=1 146 302 8.0E-09
sp|B5XF11|KDM8_SALSA Lysine-specific demethylase 8 OS=Salmo salar GN=kdm8 PE=2 SV=1 146 302 8.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8RWR1|JMJ30_ARATH Putative lysine-specific demethylase JMJD5 OS=Arabidopsis thaliana GN=JMJD5 PE=2 SV=1 127 302 2.0E-11
sp|Q55DF5|JMJCD_DICDI JmjC domain-containing protein D OS=Dictyostelium discoideum GN=jcdD PE=3 SV=1 146 287 1.0E-09
sp|Q54FG7|JMJCF_DICDI JmjC domain-containing protein F OS=Dictyostelium discoideum GN=jcdF PE=3 SV=1 146 286 4.0E-09
sp|B2GUS6|KDM8_XENTR Lysine-specific demethylase 8 OS=Xenopus tropicalis GN=kdm8 PE=2 SV=1 146 302 8.0E-09
sp|B5XF11|KDM8_SALSA Lysine-specific demethylase 8 OS=Salmo salar GN=kdm8 PE=2 SV=1 146 302 8.0E-09
sp|A8E534|KDM8_DANRE Lysine-specific demethylase 8 OS=Danio rerio GN=kdm8 PE=2 SV=1 146 302 1.0E-07
sp|P0C870|JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 121 302 1.0E-07
sp|Q497B8|KDM8_RAT Lysine-specific demethylase 8 OS=Rattus norvegicus GN=Kdm8 PE=2 SV=1 146 302 6.0E-07
sp|Q9CXT6|KDM8_MOUSE Lysine-specific demethylase 8 OS=Mus musculus GN=Kdm8 PE=2 SV=1 146 302 8.0E-07
sp|P0C872|JMJD7_MOUSE JmjC domain-containing protein 7 OS=Mus musculus GN=Jmjd7 PE=1 SV=1 154 302 1.0E-06
sp|Q8N371|KDM8_HUMAN Lysine-specific demethylase 8 OS=Homo sapiens GN=KDM8 PE=1 SV=1 146 302 7.0E-06
sp|Q1JP61|KDM8_BOVIN Lysine-specific demethylase 8 OS=Bos taurus GN=KDM8 PE=2 SV=1 146 302 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|637
MQRMDATFRNYIEQLALPAKKPLLFHNGTASPATQLPALHKWFSKDESTERAFAAYMMKFQESGPFPYELTLPSP
EATDAVARFRDWLTGSADVMDHVLAGIIQSTLSEGEGQTFFQLYSPLRLLIRALEFNRSQESKAMSTLHLYIAQS
ALGELPSPLQDDLPTPWLVQRTGHVYSSSIWLGTTPTYTPLHRDPNPNLFCQLCGSKVVRLLPPSSGDRLFFEVQ
VKIRQRGNSRIRTSEMMEGPERQALHEAVWNPDTQPEELHEVELSAGDALFIPVGWWHSVKSREADSQLNGSVNW
WFR*
Coding >Hirsu2|637
ATGCAGAGGATGGACGCGACGTTTCGCAACTACATCGAACAGCTGGCCTTGCCCGCCAAGAAGCCACTGCTCTTC
CACAATGGCACGGCATCGCCGGCCACGCAGCTGCCGGCCTTGCACAAGTGGTTCAGCAAGGATGAGTCGACGGAA
CGCGCGTTCGCTGCGTACATGATGAAATTCCAGGAATCGGGGCCGTTCCCTTACGAGCTGACGCTGCCGTCTCCG
GAGGCAACGGATGCTGTTGCACGTTTCCGTGACTGGCTTACTGGAAGCGCTGACGTGATGGATCACGTCCTGGCC
GGCATAATACAATCCACACTGAGTGAAGGCGAAGGACAGACTTTCTTCCAGCTCTACAGCCCCCTGAGGCTCCTC
ATCAGGGCGCTCGAATTCAACAGGAGTCAAGAGTCGAAGGCTATGAGCACCCTGCACCTTTACATTGCCCAGTCC
GCGCTCGGGGAGCTGCCCTCGCCTCTGCAGGACGATCTGCCGACCCCCTGGCTCGTACAGCGCACTGGTCATGTG
TATAGCTCCTCCATCTGGCTGGGTACCACGCCGACCTACACTCCGTTACACAGGGACCCCAACCCCAACTTGTTC
TGCCAGCTCTGCGGATCCAAGGTCGTAAGGCTTTTGCCGCCCTCGTCGGGGGATCGCCTGTTTTTTGAAGTACAG
GTCAAGATTCGCCAGCGGGGCAACAGTCGCATCCGCACAAGTGAGATGATGGAAGGGCCAGAGCGGCAGGCTCTG
CACGAGGCCGTCTGGAATCCTGATACCCAGCCGGAAGAGCTGCACGAGGTGGAACTGAGCGCGGGAGACGCTTTG
TTCATCCCTGTCGGATGGTGGCATTCGGTCAAGAGTAGGGAGGCGGACTCGCAGCTGAACGGCAGCGTGAACTGG
TGGTTTCGATGA
Transcript >Hirsu2|637
ATGCAGAGGATGGACGCGACGTTTCGCAACTACATCGAACAGCTGGCCTTGCCCGCCAAGAAGCCACTGCTCTTC
CACAATGGCACGGCATCGCCGGCCACGCAGCTGCCGGCCTTGCACAAGTGGTTCAGCAAGGATGAGTCGACGGAA
CGCGCGTTCGCTGCGTACATGATGAAATTCCAGGAATCGGGGCCGTTCCCTTACGAGCTGACGCTGCCGTCTCCG
GAGGCAACGGATGCTGTTGCACGTTTCCGTGACTGGCTTACTGGAAGCGCTGACGTGATGGATCACGTCCTGGCC
GGCATAATACAATCCACACTGAGTGAAGGCGAAGGACAGACTTTCTTCCAGCTCTACAGCCCCCTGAGGCTCCTC
ATCAGGGCGCTCGAATTCAACAGGAGTCAAGAGTCGAAGGCTATGAGCACCCTGCACCTTTACATTGCCCAGTCC
GCGCTCGGGGAGCTGCCCTCGCCTCTGCAGGACGATCTGCCGACCCCCTGGCTCGTACAGCGCACTGGTCATGTG
TATAGCTCCTCCATCTGGCTGGGTACCACGCCGACCTACACTCCGTTACACAGGGACCCCAACCCCAACTTGTTC
TGCCAGCTCTGCGGATCCAAGGTCGTAAGGCTTTTGCCGCCCTCGTCGGGGGATCGCCTGTTTTTTGAAGTACAG
GTCAAGATTCGCCAGCGGGGCAACAGTCGCATCCGCACAAGTGAGATGATGGAAGGGCCAGAGCGGCAGGCTCTG
CACGAGGCCGTCTGGAATCCTGATACCCAGCCGGAAGAGCTGCACGAGGTGGAACTGAGCGCGGGAGACGCTTTG
TTCATCCCTGTCGGATGGTGGCATTCGGTCAAGAGTAGGGAGGCGGACTCGCAGCTGAACGGCAGCGTGAACTGG
TGGTTTCGATGA
Gene >Hirsu2|637
ATGCAGAGGATGGACGCGACGTTTCGCAACTGTTAGCGGCAAAGCCGGCGCGCTGCTTCCCGTGCAGACCGTTAC
TGCTGTGCCGTCGGCAAACGACCGCTCAGACATCGAACAGCTGGCCTTGCCCGCCAAGAAGCCACTGCTCTTCCA
CAATGGCACGGCATCGCCGGCCACGCAGCTGCCGGCCTTGCACAAGTGGTTCAGCAAGGATGAGTCGACGGAACG
CGCGTTCGCTGCGTACATGATGAAATTCCAGGAATCGGGGCCGTTCCCTTACGAGCTGACGCTGCCGTCTCCGGA
GGCAACGGATGCTGTTGCACGTTTCCGTGACTGGCTTACTGGAAGCGCTGACGTGATGGATCACGTCCTGGCCGG
CATAATACAATCCACACTGAGTGAAGGCGAAGGACAGACTTTCTTCCAGCTCTACAGCCCCCTGAGGCTCCTCAT
CAGGGCGCTCGAATTCAACAGGAGTCAAGAGTCGAAGGCTATGAGCACCCTGCACCTTTACATTGCCCAGTCCGC
GCTCGGGGAGCTGCCCTCGCCTCTGCAGGACGATCTGCCGACCCCCTGGCTCGTACAGCGCACTGGTCATGTGTA
TAGCTCCTCCATCTGGCTGGGTACCACGCCGACCTACACTCCGTTACACAGGGACCCCAACCCCAACTTGTTCTG
CCAGCTCTGCGGATCCAAGGTCGTAAGGCTTTTGCCGCCCTCGTCGGGGGATCGCCTGTTTTTTGAAGTACAGGT
CAAGATTCGCCAGCGGGGCAACAGTCGCATCCGCACAAGTGAGATGATGGAAGGGCCAGAGCGGCAGGCTCTGCA
CGAGGCCGTCTGGAATCCTGATACCCAGCCGGAAGAGCTGCACGAGGTGGAACTGAGCGCGGGAGACGCTTTGTT
CATCCCTGTCGGATGGTGGCATTCGGTCAAGAGTAGGGAGGCGGACTCGCAGCTGAACGGCAGCGTGAACTGGTG
GTTTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail