Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6367
Gene name
LocationContig_325:11609..12749
Strand+
Gene length (bp)1140
Transcript length (bp)1140
Coding sequence length (bp)1140
Protein length (aa) 380

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3355 0.8304 0.0698 0.0267 0.0931 0.0024 0.0718 0.0435 0.0422 0.0033

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5469
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6688
Ophiocordyceps australis map64 (Brazil) OphauB2|7190
Ophiocordyceps camponoti-floridani Ophcf2|06284
Ophiocordyceps camponoti-rufipedis Ophun1|4968
Ophiocordyceps kimflemingae Ophio5|1716
Ophiocordyceps subramaniannii Hirsu2|6367 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6367
MHPSSSSPSFPAPLRRAEPPPLLSRDAVRQAAYDFGVPSPPLIPITMHQPTRNSSRQTGQSEPPQWPVAASPVAE
LTTDLTGEAPLRPSMDNAGTTQLSQQQLAIITGGVVEEADDRVHSWQYGQRHVAQRILHFLWLGPTSVVRNEAFM
RRECFTLVLIVRDAARATPLAGTEKAAAALGVPGLYVDVVAPPDGLIRAYPLAMRAVNDHMLAMHGRHGGPSSPG
KVLVTCESGSERAPGVVAGYVMAMYGVGILAAVRFVNTQRLCCCFTEDVKQSLLTWDSMLRARMAVDHAPLLAVQ
HEAGLLASQQEQEEEGRRLQSAGGFVGVADPGRKHKRRHGEMTDAEATGSDVACLGYDDERFLDRGRFAPFVVGS
QDSA*
Coding >Hirsu2|6367
ATGCACCCGTCATCGTCCTCTCCTTCTTTTCCCGCGCCCCTTCGCCGTGCGGAGCCGCCGCCGCTGCTGTCGCGG
GATGCCGTTCGACAGGCGGCCTACGACTTCGGCGTGCCGAGCCCGCCCTTGATCCCCATCACGATGCACCAGCCG
ACGCGGAACTCGTCCCGACAGACGGGCCAGTCTGAGCCTCCGCAGTGGCCCGTCGCCGCCAGCCCGGTCGCGGAG
CTGACGACGGACCTGACGGGCGAGGCGCCTCTGCGTCCGTCGATGGACAACGCCGGCACGACGCAGCTGTCGCAG
CAGCAGCTCGCCATCATCACGGGCGGCGTGGTGGAGGAGGCCGACGACCGCGTCCACTCGTGGCAGTACGGCCAG
CGGCACGTCGCCCAGCGCATCCTGCACTTCCTCTGGCTGGGCCCCACGTCGGTCGTGCGCAACGAGGCCTTCATG
CGCCGCGAGTGCTTCACCCTCGTCCTCATCGTCCGCGACGCCGCCCGGGCCACGCCGCTCGCCGGCACCGAGAAG
GCCGCCGCCGCCCTGGGCGTCCCGGGCCTCTACGTCGACGTGGTCGCGCCGCCCGACGGCCTCATCCGCGCGTAC
CCGCTGGCCATGCGCGCCGTCAACGACCACATGCTGGCCATGCACGGCCGGCACGGCGGGCCCTCGAGCCCCGGA
AAGGTCCTCGTCACCTGCGAGTCGGGCAGCGAGCGCGCCCCGGGCGTCGTCGCCGGCTACGTCATGGCCATGTAC
GGCGTCGGCATCCTGGCCGCCGTCCGATTCGTCAACACGCAGCGCCTCTGCTGCTGCTTCACCGAGGACGTCAAG
CAGTCCCTGCTGACGTGGGACAGCATGCTGCGTGCTCGCATGGCCGTCGATCACGCCCCGCTGCTCGCCGTGCAA
CACGAGGCTGGCTTGTTGGCTTCGCAGCAAGAGCAAGAGGAAGAAGGACGACGACTGCAGTCGGCGGGAGGGTTC
GTGGGCGTTGCTGACCCCGGCCGCAAGCACAAGCGTCGACACGGCGAGATGACGGACGCCGAGGCCACGGGCTCA
GACGTGGCGTGTCTGGGCTACGACGACGAGCGATTTCTCGATCGGGGCCGCTTTGCGCCCTTTGTGGTCGGGAGC
CAGGATTCGGCATAG
Transcript >Hirsu2|6367
ATGCACCCGTCATCGTCCTCTCCTTCTTTTCCCGCGCCCCTTCGCCGTGCGGAGCCGCCGCCGCTGCTGTCGCGG
GATGCCGTTCGACAGGCGGCCTACGACTTCGGCGTGCCGAGCCCGCCCTTGATCCCCATCACGATGCACCAGCCG
ACGCGGAACTCGTCCCGACAGACGGGCCAGTCTGAGCCTCCGCAGTGGCCCGTCGCCGCCAGCCCGGTCGCGGAG
CTGACGACGGACCTGACGGGCGAGGCGCCTCTGCGTCCGTCGATGGACAACGCCGGCACGACGCAGCTGTCGCAG
CAGCAGCTCGCCATCATCACGGGCGGCGTGGTGGAGGAGGCCGACGACCGCGTCCACTCGTGGCAGTACGGCCAG
CGGCACGTCGCCCAGCGCATCCTGCACTTCCTCTGGCTGGGCCCCACGTCGGTCGTGCGCAACGAGGCCTTCATG
CGCCGCGAGTGCTTCACCCTCGTCCTCATCGTCCGCGACGCCGCCCGGGCCACGCCGCTCGCCGGCACCGAGAAG
GCCGCCGCCGCCCTGGGCGTCCCGGGCCTCTACGTCGACGTGGTCGCGCCGCCCGACGGCCTCATCCGCGCGTAC
CCGCTGGCCATGCGCGCCGTCAACGACCACATGCTGGCCATGCACGGCCGGCACGGCGGGCCCTCGAGCCCCGGA
AAGGTCCTCGTCACCTGCGAGTCGGGCAGCGAGCGCGCCCCGGGCGTCGTCGCCGGCTACGTCATGGCCATGTAC
GGCGTCGGCATCCTGGCCGCCGTCCGATTCGTCAACACGCAGCGCCTCTGCTGCTGCTTCACCGAGGACGTCAAG
CAGTCCCTGCTGACGTGGGACAGCATGCTGCGTGCTCGCATGGCCGTCGATCACGCCCCGCTGCTCGCCGTGCAA
CACGAGGCTGGCTTGTTGGCTTCGCAGCAAGAGCAAGAGGAAGAAGGACGACGACTGCAGTCGGCGGGAGGGTTC
GTGGGCGTTGCTGACCCCGGCCGCAAGCACAAGCGTCGACACGGCGAGATGACGGACGCCGAGGCCACGGGCTCA
GACGTGGCGTGTCTGGGCTACGACGACGAGCGATTTCTCGATCGGGGCCGCTTTGCGCCCTTTGTGGTCGGGAGC
CAGGATTCGGCATAG
Gene >Hirsu2|6367
ATGCACCCGTCATCGTCCTCTCCTTCTTTTCCCGCGCCCCTTCGCCGTGCGGAGCCGCCGCCGCTGCTGTCGCGG
GATGCCGTTCGACAGGCGGCCTACGACTTCGGCGTGCCGAGCCCGCCCTTGATCCCCATCACGATGCACCAGCCG
ACGCGGAACTCGTCCCGACAGACGGGCCAGTCTGAGCCTCCGCAGTGGCCCGTCGCCGCCAGCCCGGTCGCGGAG
CTGACGACGGACCTGACGGGCGAGGCGCCTCTGCGTCCGTCGATGGACAACGCCGGCACGACGCAGCTGTCGCAG
CAGCAGCTCGCCATCATCACGGGCGGCGTGGTGGAGGAGGCCGACGACCGCGTCCACTCGTGGCAGTACGGCCAG
CGGCACGTCGCCCAGCGCATCCTGCACTTCCTCTGGCTGGGCCCCACGTCGGTCGTGCGCAACGAGGCCTTCATG
CGCCGCGAGTGCTTCACCCTCGTCCTCATCGTCCGCGACGCCGCCCGGGCCACGCCGCTCGCCGGCACCGAGAAG
GCCGCCGCCGCCCTGGGCGTCCCGGGCCTCTACGTCGACGTGGTCGCGCCGCCCGACGGCCTCATCCGCGCGTAC
CCGCTGGCCATGCGCGCCGTCAACGACCACATGCTGGCCATGCACGGCCGGCACGGCGGGCCCTCGAGCCCCGGA
AAGGTCCTCGTCACCTGCGAGTCGGGCAGCGAGCGCGCCCCGGGCGTCGTCGCCGGCTACGTCATGGCCATGTAC
GGCGTCGGCATCCTGGCCGCCGTCCGATTCGTCAACACGCAGCGCCTCTGCTGCTGCTTCACCGAGGACGTCAAG
CAGTCCCTGCTGACGTGGGACAGCATGCTGCGTGCTCGCATGGCCGTCGATCACGCCCCGCTGCTCGCCGTGCAA
CACGAGGCTGGCTTGTTGGCTTCGCAGCAAGAGCAAGAGGAAGAAGGACGACGACTGCAGTCGGCGGGAGGGTTC
GTGGGCGTTGCTGACCCCGGCCGCAAGCACAAGCGTCGACACGGCGAGATGACGGACGCCGAGGCCACGGGCTCA
GACGTGGCGTGTCTGGGCTACGACGACGAGCGATTTCTCGATCGGGGCCGCTTTGCGCCCTTTGTGGTCGGGAGC
CAGGATTCGGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail