Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6365
Gene name
LocationContig_325:6612..7473
Strand-
Gene length (bp)861
Transcript length (bp)714
Coding sequence length (bp)714
Protein length (aa) 238

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00957 Synaptobrevin Synaptobrevin 7.1E-30 148 231
PF13774 Longin Regulated-SNARE-like domain 1.8E-27 38 130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FMR5|VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana GN=VAMP714 PE=1 SV=1 11 230 3.0E-29
sp|O49377|VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana GN=VAMP711 PE=1 SV=2 11 213 4.0E-29
sp|Q86AQ7|VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum GN=vamp7B PE=3 SV=1 10 219 6.0E-29
sp|Q9LFP1|VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana GN=VAMP713 PE=2 SV=1 11 226 2.0E-28
sp|Q9SIQ9|VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana GN=VAMP712 PE=2 SV=1 11 213 3.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9FMR5|VA714_ARATH Vesicle-associated membrane protein 714 OS=Arabidopsis thaliana GN=VAMP714 PE=1 SV=1 11 230 3.0E-29
sp|O49377|VA711_ARATH Vesicle-associated membrane protein 711 OS=Arabidopsis thaliana GN=VAMP711 PE=1 SV=2 11 213 4.0E-29
sp|Q86AQ7|VAM7B_DICDI Vesicle-associated membrane protein 7B OS=Dictyostelium discoideum GN=vamp7B PE=3 SV=1 10 219 6.0E-29
sp|Q9LFP1|VA713_ARATH Vesicle-associated membrane protein 713 OS=Arabidopsis thaliana GN=VAMP713 PE=2 SV=1 11 226 2.0E-28
sp|Q9SIQ9|VA712_ARATH Vesicle-associated membrane protein 712 OS=Arabidopsis thaliana GN=VAMP712 PE=2 SV=1 11 213 3.0E-28
sp|Q9MAS5|VA726_ARATH Putative vesicle-associated membrane protein 726 OS=Arabidopsis thaliana GN=VAMP726 PE=2 SV=2 10 214 6.0E-25
sp|P47192|VA722_ARATH Vesicle-associated membrane protein 722 OS=Arabidopsis thaliana GN=VAMP722 PE=2 SV=2 11 214 1.0E-24
sp|Q54NW7|VAM7A_DICDI Vesicle-associated membrane protein 7A OS=Dictyostelium discoideum GN=vamp7A PE=1 SV=1 9 233 2.0E-24
sp|O48850|VA725_ARATH Vesicle-associated membrane protein 725 OS=Arabidopsis thaliana GN=VAMP725 PE=2 SV=2 11 214 5.0E-24
sp|Q9ZTW3|VA721_ARATH Vesicle-associated membrane protein 721 OS=Arabidopsis thaliana GN=VAMP721 PE=1 SV=1 11 214 1.0E-23
sp|Q5ZL74|VAMP7_CHICK Vesicle-associated membrane protein 7 OS=Gallus gallus GN=VAMP7 PE=2 SV=1 11 214 3.0E-22
sp|Q9JHW5|VAMP7_RAT Vesicle-associated membrane protein 7 OS=Rattus norvegicus GN=Vamp7 PE=1 SV=1 11 216 3.0E-22
sp|Q9M376|VA727_ARATH Vesicle-associated membrane protein 727 OS=Arabidopsis thaliana GN=VAMP727 PE=2 SV=1 11 228 3.0E-22
sp|P51809|VAMP7_HUMAN Vesicle-associated membrane protein 7 OS=Homo sapiens GN=VAMP7 PE=1 SV=3 11 214 7.0E-22
sp|Q17QI5|VAMP7_BOVIN Vesicle-associated membrane protein 7 OS=Bos taurus GN=VAMP7 PE=2 SV=1 11 214 8.0E-22
sp|Q5RF94|VAMP7_PONAB Vesicle-associated membrane protein 7 OS=Pongo abelii GN=VAMP7 PE=2 SV=3 11 214 2.0E-21
sp|P70280|VAMP7_MOUSE Vesicle-associated membrane protein 7 OS=Mus musculus GN=Vamp7 PE=1 SV=1 11 214 6.0E-21
sp|O23429|VA724_ARATH Vesicle-associated membrane protein 724 OS=Arabidopsis thaliana GN=VAMP724 PE=2 SV=2 11 214 6.0E-19
sp|Q3T0Y8|VAMP8_BOVIN Vesicle-associated membrane protein 8 OS=Bos taurus GN=VAMP8 PE=3 SV=1 142 219 6.0E-16
sp|Q12255|NYV1_YEAST Vacuolar v-SNARE NYV1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NYV1 PE=1 SV=2 151 228 7.0E-15
sp|Q5REQ5|VAMP8_PONAB Vesicle-associated membrane protein 8 OS=Pongo abelii GN=VAMP8 PE=3 SV=1 142 219 2.0E-14
sp|Q9BV40|VAMP8_HUMAN Vesicle-associated membrane protein 8 OS=Homo sapiens GN=VAMP8 PE=1 SV=1 142 219 2.0E-14
sp|O75379|VAMP4_HUMAN Vesicle-associated membrane protein 4 OS=Homo sapiens GN=VAMP4 PE=1 SV=2 141 218 3.0E-14
sp|Q32L97|VAMP4_BOVIN Vesicle-associated membrane protein 4 OS=Bos taurus GN=VAMP4 PE=2 SV=1 141 218 3.0E-14
sp|O70480|VAMP4_MOUSE Vesicle-associated membrane protein 4 OS=Mus musculus GN=Vamp4 PE=1 SV=1 141 214 4.0E-13
sp|O70404|VAMP8_MOUSE Vesicle-associated membrane protein 8 OS=Mus musculus GN=Vamp8 PE=1 SV=1 137 214 9.0E-13
sp|Q9WUF4|VAMP8_RAT Vesicle-associated membrane protein 8 OS=Rattus norvegicus GN=Vamp8 PE=1 SV=1 142 214 2.0E-12
sp|Q8VY69|VA723_ARATH Vesicle-associated membrane protein 723 OS=Arabidopsis thaliana GN=VAMP723 PE=2 SV=1 11 214 2.0E-12
sp|P18489|SYB_DROME Synaptobrevin OS=Drosophila melanogaster GN=Syb PE=2 SV=3 157 233 3.0E-12
sp|Q92356|SYB1_SCHPO Synaptobrevin homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=syb1 PE=3 SV=1 155 214 8.0E-12
sp|P33328|SNC2_YEAST Synaptobrevin homolog 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNC2 PE=1 SV=2 155 218 2.0E-11
sp|Q9Y7L0|SEC22_SCHPO Protein transport protein sec22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec22 PE=3 SV=2 38 226 4.0E-11
sp|Q7ZV15|S22BA_DANRE Vesicle-trafficking protein SEC22b-A OS=Danio rerio GN=sec22ba PE=2 SV=1 36 226 1.0E-10
sp|Q60WU2|SYB1_CAEBR Synaptobrevin-1 OS=Caenorhabditis briggsae GN=snb-1 PE=3 SV=1 139 218 5.0E-10
sp|Q5ZJW4|SC22B_CHICK Vesicle-trafficking protein SEC22b OS=Gallus gallus GN=SEC22B PE=2 SV=1 32 226 7.0E-10
sp|O02495|SYB1_CAEEL Synaptobrevin-1 OS=Caenorhabditis elegans GN=snb-1 PE=1 SV=1 157 219 8.0E-10
sp|Q4KM74|SC22B_RAT Vesicle-trafficking protein SEC22b OS=Rattus norvegicus GN=Sec22b PE=1 SV=3 32 226 2.0E-09
sp|Q5RAI9|SC22B_PONAB Vesicle-trafficking protein SEC22b OS=Pongo abelii GN=SEC22B PE=2 SV=3 32 226 2.0E-09
sp|O08547|SC22B_MOUSE Vesicle-trafficking protein SEC22b OS=Mus musculus GN=Sec22b PE=1 SV=3 32 226 2.0E-09
sp|O08595|SC22B_CRIGR Vesicle-trafficking protein SEC22b OS=Cricetulus griseus GN=Sec22b PE=1 SV=3 32 226 3.0E-09
sp|Q54GB3|SYBB_DICDI Synaptobrevin-B OS=Dictyostelium discoideum GN=sybB PE=3 SV=1 145 233 4.0E-09
sp|P63045|VAMP2_RAT Vesicle-associated membrane protein 2 OS=Rattus norvegicus GN=Vamp2 PE=1 SV=2 157 220 1.0E-08
sp|P63044|VAMP2_MOUSE Vesicle-associated membrane protein 2 OS=Mus musculus GN=Vamp2 PE=1 SV=2 157 220 1.0E-08
sp|Q9N0Y0|VAMP2_MACMU Vesicle-associated membrane protein 2 OS=Macaca mulatta GN=VAMP2 PE=3 SV=3 157 220 1.0E-08
sp|P63027|VAMP2_HUMAN Vesicle-associated membrane protein 2 OS=Homo sapiens GN=VAMP2 PE=1 SV=3 157 220 1.0E-08
sp|P63026|VAMP2_BOVIN Vesicle-associated membrane protein 2 OS=Bos taurus GN=VAMP2 PE=1 SV=2 157 220 1.0E-08
sp|Q62442|VAMP1_MOUSE Vesicle-associated membrane protein 1 OS=Mus musculus GN=Vamp1 PE=1 SV=1 157 221 1.0E-08
sp|Q0V7N0|VAMP1_BOVIN Vesicle-associated membrane protein 1 OS=Bos taurus GN=VAMP1 PE=3 SV=2 157 221 1.0E-08
sp|Q15836|VAMP3_HUMAN Vesicle-associated membrane protein 3 OS=Homo sapiens GN=VAMP3 PE=1 SV=3 144 217 2.0E-08
sp|O75396|SC22B_HUMAN Vesicle-trafficking protein SEC22b OS=Homo sapiens GN=SEC22B PE=1 SV=4 32 226 2.0E-08
sp|Q4R8T0|VAMP3_MACFA Vesicle-associated membrane protein 3 OS=Macaca fascicularis GN=VAMP3 PE=3 SV=1 141 217 2.0E-08
sp|Q7SXP0|S22BB_DANRE Vesicle-trafficking protein SEC22b-B OS=Danio rerio GN=sec22bb PE=2 SV=1 33 226 2.0E-08
sp|P63025|VAMP3_RAT Vesicle-associated membrane protein 3 OS=Rattus norvegicus GN=Vamp3 PE=1 SV=1 142 216 3.0E-08
sp|P63024|VAMP3_MOUSE Vesicle-associated membrane protein 3 OS=Mus musculus GN=Vamp3 PE=1 SV=1 142 216 3.0E-08
sp|P35589|SYB_APLCA Synaptobrevin OS=Aplysia californica PE=2 SV=1 157 218 3.0E-08
sp|P47193|VAMP2_XENLA Vesicle-associated membrane protein 2 OS=Xenopus laevis GN=vamp2 PE=3 SV=3 157 220 3.0E-08
sp|P13701|SYB_TORCA Synaptobrevin OS=Torpedo californica PE=2 SV=1 157 218 5.0E-08
sp|P31109|SNC1_YEAST Synaptobrevin homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNC1 PE=1 SV=1 157 214 5.0E-08
sp|P23763|VAMP1_HUMAN Vesicle-associated membrane protein 1 OS=Homo sapiens GN=VAMP1 PE=1 SV=1 157 221 5.0E-08
sp|Q63666|VAMP1_RAT Vesicle-associated membrane protein 1 OS=Rattus norvegicus GN=Vamp1 PE=1 SV=2 157 221 7.0E-08
sp|Q6P7L4|SC22B_XENTR Vesicle-trafficking protein SEC22b OS=Xenopus tropicalis GN=sec22b PE=2 SV=1 33 226 7.0E-08
sp|Q757A4|YKT6_ASHGO Synaptobrevin homolog YKT6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YKT6 PE=3 SV=1 80 201 1.0E-07
sp|P47194|SYB_DORPE Synaptobrevin OS=Doryteuthis pealeii PE=1 SV=1 157 218 1.0E-07
sp|Q2KJD2|VAMP3_BOVIN Vesicle-associated membrane protein 3 OS=Bos taurus GN=VAMP3 PE=3 SV=1 151 216 1.0E-07
sp|Q6BSL0|YKT6_DEBHA Synaptobrevin homolog YKT6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YKT6 PE=3 SV=1 80 201 2.0E-07
sp|Q6C880|SEC22_YARLI Protein transport protein SEC22 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC22 PE=3 SV=1 32 208 3.0E-07
sp|Q6C537|YKT6_YARLI Synaptobrevin homolog YKT6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YKT6 PE=3 SV=1 78 196 5.0E-07
sp|Q27236|SYBL_SCHMA Synaptobrevin-like protein OS=Schistosoma mansoni PE=2 SV=1 157 216 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016192 vesicle-mediated transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 214 233 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6365
MASSSTPATPLLYSCIAHKTTILSECTTSASSQASSLASLILPKIEHATPQKLTYTHGQHQIHYLSEAPSEHPEH
PAAGGLTFLVVADAALGRRVPFGFLLEIRRRFLDAFPPASTDLAELPNYGAGAFNAELRRLMVDYGATAGGRDDA
IGNARREIDDVRGIMTRNIESLLERGERVDLLVDKTDRLGGSAREFRVRSRGLKRQMWWKNVKLMALLALVLVLI
VVAIVIGVKNAS*
Coding >Hirsu2|6365
ATGGCGTCGTCATCCACACCGGCCACGCCCCTGCTATACTCGTGCATCGCGCACAAGACGACGATCCTGTCGGAA
TGCACGACGTCGGCGTCGTCGCAGGCGTCGTCGCTGGCGTCGCTGATCCTGCCCAAGATCGAGCACGCGACGCCG
CAGAAGTTGACGTACACGCACGGCCAGCACCAGATCCACTACCTGTCGGAGGCGCCGTCGGAGCACCCGGAGCAC
CCGGCGGCGGGCGGGCTGACGTTCCTGGTGGTGGCGGACGCGGCGCTGGGCCGGCGCGTGCCCTTCGGCTTCCTG
CTCGAGATCCGGCGGCGCTTCCTCGACGCCTTCCCGCCCGCCAGCACCGACCTGGCCGAGCTGCCCAACTACGGC
GCCGGCGCCTTCAACGCCGAGCTGCGCCGCCTCATGGTCGACTACGGCGCCACGGCCGGCGGCCGCGACGACGCC
ATCGGCAACGCCCGCCGCGAGATTGACGACGTCCGCGGCATCATGACGCGCAACATCGAGAGCCTGCTCGAGCGC
GGCGAGCGCGTCGACCTGCTCGTCGACAAGACGGACCGCCTCGGCGGCAGCGCCCGCGAGTTCCGCGTCCGCAGC
CGCGGCCTCAAGCGCCAGATGTGGTGGAAGAACGTCAAGCTCATGGCCCTGCTCGCCCTCGTCCTCGTCCTCATC
GTCGTCGCCATCGTCATCGGCGTCAAGAACGCCTCCTGA
Transcript >Hirsu2|6365
ATGGCGTCGTCATCCACACCGGCCACGCCCCTGCTATACTCGTGCATCGCGCACAAGACGACGATCCTGTCGGAA
TGCACGACGTCGGCGTCGTCGCAGGCGTCGTCGCTGGCGTCGCTGATCCTGCCCAAGATCGAGCACGCGACGCCG
CAGAAGTTGACGTACACGCACGGCCAGCACCAGATCCACTACCTGTCGGAGGCGCCGTCGGAGCACCCGGAGCAC
CCGGCGGCGGGCGGGCTGACGTTCCTGGTGGTGGCGGACGCGGCGCTGGGCCGGCGCGTGCCCTTCGGCTTCCTG
CTCGAGATCCGGCGGCGCTTCCTCGACGCCTTCCCGCCCGCCAGCACCGACCTGGCCGAGCTGCCCAACTACGGC
GCCGGCGCCTTCAACGCCGAGCTGCGCCGCCTCATGGTCGACTACGGCGCCACGGCCGGCGGCCGCGACGACGCC
ATCGGCAACGCCCGCCGCGAGATTGACGACGTCCGCGGCATCATGACGCGCAACATCGAGAGCCTGCTCGAGCGC
GGCGAGCGCGTCGACCTGCTCGTCGACAAGACGGACCGCCTCGGCGGCAGCGCCCGCGAGTTCCGCGTCCGCAGC
CGCGGCCTCAAGCGCCAGATGTGGTGGAAGAACGTCAAGCTCATGGCCCTGCTCGCCCTCGTCCTCGTCCTCATC
GTCGTCGCCATCGTCATCGGCGTCAAGAACGCCTCCTGA
Gene >Hirsu2|6365
ATGGCGTCGTCATCCACACCGGCCACGCCCCTGCTATAGTACGTTTCCCCCTCCGCTTTCCCCTCTCGCCCTCGC
TTCCCTTCAGGAGGAAGAACAAGAAAAGGGGACGGGAGGGGAGGGTGGGGAGAAGGGAAGGGCGCAGACTCGGGC
GCGGCTAAAATATATATATCAACAAAAACACACAGCTCGTGCATCGCGCACAAGACGACGATCCTGTCGGAATGC
ACGACGTCGGCGTCGTCGCAGGCGTCGTCGCTGGCGTCGCTGATCCTGCCCAAGATCGAGCACGCGACGCCGCAG
AAGTTGACGTACACGCACGGCCAGCACCAGATCCACTACCTGTCGGAGGCGCCGTCGGAGCACCCGGAGCACCCG
GCGGCGGGCGGGCTGACGTTCCTGGTGGTGGCGGACGCGGCGCTGGGCCGGCGCGTGCCCTTCGGCTTCCTGCTC
GAGATCCGGCGGCGCTTCCTCGACGCCTTCCCGCCCGCCAGCACCGACCTGGCCGAGCTGCCCAACTACGGCGCC
GGCGCCTTCAACGCCGAGCTGCGCCGCCTCATGGTCGACTACGGCGCCACGGCCGGCGGCCGCGACGACGCCATC
GGCAACGCCCGCCGCGAGATTGACGACGTCCGCGGCATCATGACGCGCAACATCGAGAGCCTGCTCGAGCGCGGC
GAGCGCGTCGACCTGCTCGTCGACAAGACGGACCGCCTCGGCGGCAGCGCCCGCGAGTTCCGCGTCCGCAGCCGC
GGCCTCAAGCGCCAGATGTGGTGGAAGAACGTCAAGCTCATGGCCCTGCTCGCCCTCGTCCTCGTCCTCATCGTC
GTCGCCATCGTCATCGGCGTCAAGAACGCCTCCTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail