Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6362
Gene name
LocationContig_325:810..1669
Strand-
Gene length (bp)859
Transcript length (bp)732
Coding sequence length (bp)732
Protein length (aa) 244

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09139 Tam41_Mmp37 Phosphatidate cytidylyltransferase, mitochondrial 4.8E-24 150 240

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53230|TAM41_YEAST Phosphatidate cytidylyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAM41 PE=1 SV=1 131 239 7.0E-14
sp|O74339|TAM41_SCHPO Phosphatidate cytidylyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tam41 PE=1 SV=3 145 239 2.0E-08
sp|Q550P4|TAM41_DICDI Phosphatidate cytidylyltransferase, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0277049 PE=3 SV=1 145 239 4.0E-08

GO

GO Term Description Terminal node
GO:0004605 phosphatidate cytidylyltransferase activity Yes
GO:0032049 cardiolipin biosynthetic process Yes
GO:0003824 catalytic activity No
GO:0009987 cellular process No
GO:0019637 organophosphate metabolic process No
GO:0046471 phosphatidylglycerol metabolic process No
GO:0006629 lipid metabolic process No
GO:0071704 organic substance metabolic process No
GO:0006793 phosphorus metabolic process No
GO:0008152 metabolic process No
GO:0006644 phospholipid metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044249 cellular biosynthetic process No
GO:0009058 biosynthetic process No
GO:0008150 biological_process No
GO:0006655 phosphatidylglycerol biosynthetic process No
GO:0032048 cardiolipin metabolic process No
GO:0046474 glycerophospholipid biosynthetic process No
GO:0070567 cytidylyltransferase activity No
GO:0044255 cellular lipid metabolic process No
GO:0045017 glycerolipid biosynthetic process No
GO:0008610 lipid biosynthetic process No
GO:0044238 primary metabolic process No
GO:0006650 glycerophospholipid metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0016779 nucleotidyltransferase activity No
GO:0006796 phosphate-containing compound metabolic process No
GO:0003674 molecular_function No
GO:1901576 organic substance biosynthetic process No
GO:0044237 cellular metabolic process No
GO:0008654 phospholipid biosynthetic process No
GO:0016740 transferase activity No
GO:0046486 glycerolipid metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6362
MAVLELRLAAAAAAPLLASASAFGATRLAPRRLASRRAVHSVSRIRTRTCWQPGTRLKSTSSRESDSSAAATAAA
SPPSPTGSSSSEGSPSSSSSSSGKRRESAGGKFNLYGDEWEDSVDFAIKSFEELPHRLFGVNQHMIINYELKEAL
RMMLRQFNAPIVYCFAYGSGVFPQESSSRSISEAEFRAVHPRPPAALVRAQKGAPKMIDFIFGVSYTQHWHSINM
RQHRGHYSAVAALGWTAC*
Coding >Hirsu2|6362
ATGGCTGTCCTCGAGCTGCGCCTCGCGGCGGCGGCGGCAGCTCCCTTGCTGGCCTCGGCCTCGGCATTCGGCGCC
ACGCGGCTTGCTCCTCGACGCCTCGCATCCCGCCGCGCGGTGCACAGCGTATCCCGGATCCGTACACGGACGTGT
TGGCAGCCGGGGACGAGGCTGAAATCGACGTCGTCGCGAGAGTCCGACTCGTCCGCCGCCGCCACCGCCGCCGCC
TCACCTCCCTCCCCGACCGGCAGCAGCTCGAGCGAGGGCAGCCCGTCGTCGTCGTCGTCGTCGTCGGGCAAGAGA
CGAGAGTCGGCGGGCGGCAAGTTCAACCTGTACGGCGACGAGTGGGAGGACTCGGTGGACTTCGCCATCAAGTCG
TTCGAGGAGCTGCCGCACCGGCTGTTCGGCGTCAACCAGCACATGATCATCAACTACGAGCTCAAGGAGGCGCTG
CGGATGATGCTGCGGCAGTTCAACGCGCCCATCGTCTACTGCTTCGCGTACGGGTCCGGCGTCTTCCCGCAGGAG
AGCAGCAGCCGCAGCATCAGCGAGGCCGAGTTCCGGGCGGTGCACCCGCGGCCGCCGGCGGCGCTGGTGCGGGCG
CAGAAGGGCGCGCCCAAGATGATCGACTTCATCTTCGGCGTCAGCTACACGCAGCACTGGCACTCGATCAACATG
CGGCAGCACCGCGGCCACTACTCGGCCGTGGCCGCGCTCGGATGGACGGCATGCTGA
Transcript >Hirsu2|6362
ATGGCTGTCCTCGAGCTGCGCCTCGCGGCGGCGGCGGCAGCTCCCTTGCTGGCCTCGGCCTCGGCATTCGGCGCC
ACGCGGCTTGCTCCTCGACGCCTCGCATCCCGCCGCGCGGTGCACAGCGTATCCCGGATCCGTACACGGACGTGT
TGGCAGCCGGGGACGAGGCTGAAATCGACGTCGTCGCGAGAGTCCGACTCGTCCGCCGCCGCCACCGCCGCCGCC
TCACCTCCCTCCCCGACCGGCAGCAGCTCGAGCGAGGGCAGCCCGTCGTCGTCGTCGTCGTCGTCGGGCAAGAGA
CGAGAGTCGGCGGGCGGCAAGTTCAACCTGTACGGCGACGAGTGGGAGGACTCGGTGGACTTCGCCATCAAGTCG
TTCGAGGAGCTGCCGCACCGGCTGTTCGGCGTCAACCAGCACATGATCATCAACTACGAGCTCAAGGAGGCGCTG
CGGATGATGCTGCGGCAGTTCAACGCGCCCATCGTCTACTGCTTCGCGTACGGGTCCGGCGTCTTCCCGCAGGAG
AGCAGCAGCCGCAGCATCAGCGAGGCCGAGTTCCGGGCGGTGCACCCGCGGCCGCCGGCGGCGCTGGTGCGGGCG
CAGAAGGGCGCGCCCAAGATGATCGACTTCATCTTCGGCGTCAGCTACACGCAGCACTGGCACTCGATCAACATG
CGGCAGCACCGCGGCCACTACTCGGCCGTGGCCGCGCTCGGATGGACGGCATGCTGA
Gene >Hirsu2|6362
ATGGCTGTCCTCGAGCTGCGCCTCGCGGTGAGTGCTCGTGTCTTGGCCATGCGCGGCGGCCTGCTGACCGACGCC
TCACGCTGTCTGCAGGCGGCGGCGGCAGCTCCCTTGCTGGCCTCGGCCTCGGCATTCGGCGCCACGCGGCTTGCT
CCTCGACGCCTCGCATCCCGCCGCGCGGTGCACAGCGTATCCCGGATCCGTACACGGACGTGTTGGCAGCCGGGG
ACGAGGCTGAAATCGACGTCGTCGCGAGAGTCCGACTCGTCCGCCGCCGCCACCGCCGCCGCCTCACCTCCCTCC
CCGACCGGCAGCAGCTCGAGCGAGGGCAGCCCGTCGTCGTCGTCGTCGTCGTCGGGCAAGAGACGAGAGTCGGCG
GGCGGCAAGTTCAACCTGTACGGCGACGAGTGGGAGGACTCGGTGGACTTCGCCATCAAGTCGTTCGAGGAGCTG
CCGCACCGGCTGTTCGGCGTCAACCAGCACATGATCATCAACTACGAGCTCAAGGAGGCGCTGCGGATGATGCTG
CGGCAGTTCAACGCGCCCATCGTCTACTGCTTCGCGTACGGGTCCGGCGTCTTCCCGCAGGAGAGCAGCAGCCGC
AGCATCAGCGAGGCCGAGTTCCGGGCGGTGCACCCGCGGCCGCCGGCGGCGCTGGTGCGGGCGCAGAAGGGCGCG
CCCAAGATGATCGACTTCATCTTCGGCGTCAGCTACACGCAGCACTGGCACTCGATCAACATGCGGCAGCACCGC
GGCCACTACTCGGCCGTGGCCGCGCTCGGGTCGGCCTTTGTGTCGCGCGTGCAGCGCTGGGGCGCCGGCGTCTAC
TTCAACCCCTACGTCGAGATGGACGGCATGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail