Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6351
Gene name
LocationContig_324:6519..7170
Strand-
Gene length (bp)651
Transcript length (bp)651
Coding sequence length (bp)651
Protein length (aa) 217

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05699 Dimer_Tnp_hAT hAT family C-terminal dimerisation region 7.6E-07 120 203

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046983 protein dimerization activity Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0005515 protein binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 66 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6351
MPRGQNAPNDNNQQLNWRNRFPEDTDLPPAYFAAQVLDPYRKWAWFRQEWVLPGDEKKKWFDSAQLAVKELWKME
YEGKYPVEMVPPPKPTERDPDPAFDRQREHKRIRIDGPVSATDLYEQYIATDRLHDDEAGCDEAIAYWLSRYDSQ
RDLARFALDLFAISPMSDECERLFSSAKLIVVDRRGRLKADIIEACECLRAWYGEQNVEDESDGDD*
Coding >Hirsu2|6351
ATGCCGCGTGGTCAAAATGCGCCGAATGACAACAATCAGCAACTGAACTGGCGAAATCGATTCCCCGAAGATACC
GACCTTCCGCCTGCATACTTTGCAGCCCAAGTCCTTGACCCATACAGAAAGTGGGCATGGTTCAGACAAGAATGG
GTTCTTCCAGGCGATGAGAAGAAGAAGTGGTTCGATAGCGCGCAATTGGCCGTGAAAGAGCTCTGGAAAATGGAG
TATGAGGGAAAATATCCCGTTGAGATGGTTCCCCCTCCGAAGCCCACGGAGAGAGATCCGGATCCCGCGTTTGAT
CGTCAGCGGGAACATAAGCGCATCCGAATTGACGGTCCGGTCTCGGCAACTGATCTGTATGAGCAATACATTGCT
ACCGACCGACTCCATGACGATGAGGCAGGTTGTGACGAGGCCATTGCGTACTGGCTGTCCCGCTATGACTCTCAG
AGAGACCTCGCTCGCTTCGCACTGGACCTTTTTGCCATCTCACCTATGTCGGATGAGTGCGAACGCCTGTTCAGT
AGCGCCAAGCTTATTGTGGTTGACCGCCGGGGCAGGCTGAAGGCCGATATTATCGAGGCATGCGAGTGTCTCCGG
GCCTGGTACGGAGAGCAAAATGTGGAAGATGAAAGTGACGGTGATGATTAA
Transcript >Hirsu2|6351
ATGCCGCGTGGTCAAAATGCGCCGAATGACAACAATCAGCAACTGAACTGGCGAAATCGATTCCCCGAAGATACC
GACCTTCCGCCTGCATACTTTGCAGCCCAAGTCCTTGACCCATACAGAAAGTGGGCATGGTTCAGACAAGAATGG
GTTCTTCCAGGCGATGAGAAGAAGAAGTGGTTCGATAGCGCGCAATTGGCCGTGAAAGAGCTCTGGAAAATGGAG
TATGAGGGAAAATATCCCGTTGAGATGGTTCCCCCTCCGAAGCCCACGGAGAGAGATCCGGATCCCGCGTTTGAT
CGTCAGCGGGAACATAAGCGCATCCGAATTGACGGTCCGGTCTCGGCAACTGATCTGTATGAGCAATACATTGCT
ACCGACCGACTCCATGACGATGAGGCAGGTTGTGACGAGGCCATTGCGTACTGGCTGTCCCGCTATGACTCTCAG
AGAGACCTCGCTCGCTTCGCACTGGACCTTTTTGCCATCTCACCTATGTCGGATGAGTGCGAACGCCTGTTCAGT
AGCGCCAAGCTTATTGTGGTTGACCGCCGGGGCAGGCTGAAGGCCGATATTATCGAGGCATGCGAGTGTCTCCGG
GCCTGGTACGGAGAGCAAAATGTGGAAGATGAAAGTGACGGTGATGATTAA
Gene >Hirsu2|6351
ATGCCGCGTGGTCAAAATGCGCCGAATGACAACAATCAGCAACTGAACTGGCGAAATCGATTCCCCGAAGATACC
GACCTTCCGCCTGCATACTTTGCAGCCCAAGTCCTTGACCCATACAGAAAGTGGGCATGGTTCAGACAAGAATGG
GTTCTTCCAGGCGATGAGAAGAAGAAGTGGTTCGATAGCGCGCAATTGGCCGTGAAAGAGCTCTGGAAAATGGAG
TATGAGGGAAAATATCCCGTTGAGATGGTTCCCCCTCCGAAGCCCACGGAGAGAGATCCGGATCCCGCGTTTGAT
CGTCAGCGGGAACATAAGCGCATCCGAATTGACGGTCCGGTCTCGGCAACTGATCTGTATGAGCAATACATTGCT
ACCGACCGACTCCATGACGATGAGGCAGGTTGTGACGAGGCCATTGCGTACTGGCTGTCCCGCTATGACTCTCAG
AGAGACCTCGCTCGCTTCGCACTGGACCTTTTTGCCATCTCACCTATGTCGGATGAGTGCGAACGCCTGTTCAGT
AGCGCCAAGCTTATTGTGGTTGACCGCCGGGGCAGGCTGAAGGCCGATATTATCGAGGCATGCGAGTGTCTCCGG
GCCTGGTACGGAGAGCAAAATGTGGAAGATGAAAGTGACGGTGATGATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail