Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6349
Gene name
LocationContig_324:1699..2434
Strand+
Gene length (bp)735
Transcript length (bp)735
Coding sequence length (bp)735
Protein length (aa) 245

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.2946 0.2004 0.0776 0.0691 0.8731 0.1937 0.0787 0.0771 0.1005 0.0456

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5983
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|10285
Ophiocordyceps subramaniannii Hirsu2|297
Ophiocordyceps subramaniannii Hirsu2|6349 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7735
Ophiocordyceps subramaniannii Hirsu2|8431

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6349
MALPQALRFCRVFVRSDAIDWFLQTWQRTLATSASLLHVTTIPTGGPITTLNLTAAVQAIDAVIAGKMEPALPRK
FGFLRFFQFLESVKSKIGNDKAQGLILREKSVVHHSPCAYSIYISAEVVATEQNDIRRNRQMGWRFHQFSVESPL
LLTVFTKTADTFAYVLTPSDLSAFTKLTSSRDPKKADESTFAVLAPRAREDIPKELRDVCQFLTTKVEEAIVSGA
SYSQYLWQGMADQIRQHLI*
Coding >Hirsu2|6349
ATGGCCCTGCCCCAAGCTTTGAGATTTTGCCGCGTTTTTGTCAGAAGCGACGCTATCGACTGGTTTTTGCAAACC
TGGCAGCGTACGCTGGCCACTTCGGCGTCATTACTACACGTCACAACAATTCCTACGGGTGGTCCCATCACTACA
CTAAATCTAACTGCGGCCGTTCAAGCTATAGACGCTGTTATTGCTGGCAAAATGGAACCAGCACTGCCACGAAAA
TTTGGCTTTTTACGATTTTTCCAATTCCTGGAATCTGTGAAGTCCAAGATTGGCAATGACAAGGCCCAGGGATTA
ATTCTCCGTGAAAAGAGTGTCGTTCATCATAGTCCTTGTGCCTATAGCATCTACATCAGTGCCGAGGTTGTGGCT
ACCGAGCAGAACGATATCCGGCGCAACAGGCAAATGGGCTGGCGCTTCCACCAATTTTCAGTTGAATCCCCTCTT
CTCTTGACCGTCTTCACTAAAACAGCGGACACGTTCGCGTACGTACTTACCCCCTCAGATCTTTCAGCTTTCACA
AAGCTCACCAGTTCCAGGGACCCAAAGAAGGCGGACGAGTCTACTTTCGCTGTGTTGGCCCCCCGAGCTCGTGAG
GACATACCTAAGGAGCTCCGAGACGTCTGTCAATTCTTAACCACGAAGGTGGAGGAAGCGATAGTCTCGGGAGCC
TCTTATAGCCAATACCTGTGGCAGGGCATGGCGGATCAAATTAGACAGCACTTGATCTAG
Transcript >Hirsu2|6349
ATGGCCCTGCCCCAAGCTTTGAGATTTTGCCGCGTTTTTGTCAGAAGCGACGCTATCGACTGGTTTTTGCAAACC
TGGCAGCGTACGCTGGCCACTTCGGCGTCATTACTACACGTCACAACAATTCCTACGGGTGGTCCCATCACTACA
CTAAATCTAACTGCGGCCGTTCAAGCTATAGACGCTGTTATTGCTGGCAAAATGGAACCAGCACTGCCACGAAAA
TTTGGCTTTTTACGATTTTTCCAATTCCTGGAATCTGTGAAGTCCAAGATTGGCAATGACAAGGCCCAGGGATTA
ATTCTCCGTGAAAAGAGTGTCGTTCATCATAGTCCTTGTGCCTATAGCATCTACATCAGTGCCGAGGTTGTGGCT
ACCGAGCAGAACGATATCCGGCGCAACAGGCAAATGGGCTGGCGCTTCCACCAATTTTCAGTTGAATCCCCTCTT
CTCTTGACCGTCTTCACTAAAACAGCGGACACGTTCGCGTACGTACTTACCCCCTCAGATCTTTCAGCTTTCACA
AAGCTCACCAGTTCCAGGGACCCAAAGAAGGCGGACGAGTCTACTTTCGCTGTGTTGGCCCCCCGAGCTCGTGAG
GACATACCTAAGGAGCTCCGAGACGTCTGTCAATTCTTAACCACGAAGGTGGAGGAAGCGATAGTCTCGGGAGCC
TCTTATAGCCAATACCTGTGGCAGGGCATGGCGGATCAAATTAGACAGCACTTGATCTAG
Gene >Hirsu2|6349
ATGGCCCTGCCCCAAGCTTTGAGATTTTGCCGCGTTTTTGTCAGAAGCGACGCTATCGACTGGTTTTTGCAAACC
TGGCAGCGTACGCTGGCCACTTCGGCGTCATTACTACACGTCACAACAATTCCTACGGGTGGTCCCATCACTACA
CTAAATCTAACTGCGGCCGTTCAAGCTATAGACGCTGTTATTGCTGGCAAAATGGAACCAGCACTGCCACGAAAA
TTTGGCTTTTTACGATTTTTCCAATTCCTGGAATCTGTGAAGTCCAAGATTGGCAATGACAAGGCCCAGGGATTA
ATTCTCCGTGAAAAGAGTGTCGTTCATCATAGTCCTTGTGCCTATAGCATCTACATCAGTGCCGAGGTTGTGGCT
ACCGAGCAGAACGATATCCGGCGCAACAGGCAAATGGGCTGGCGCTTCCACCAATTTTCAGTTGAATCCCCTCTT
CTCTTGACCGTCTTCACTAAAACAGCGGACACGTTCGCGTACGTACTTACCCCCTCAGATCTTTCAGCTTTCACA
AAGCTCACCAGTTCCAGGGACCCAAAGAAGGCGGACGAGTCTACTTTCGCTGTGTTGGCCCCCCGAGCTCGTGAG
GACATACCTAAGGAGCTCCGAGACGTCTGTCAATTCTTAACCACGAAGGTGGAGGAAGCGATAGTCTCGGGAGCC
TCTTATAGCCAATACCTGTGGCAGGGCATGGCGGATCAAATTAGACAGCACTTGATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail