Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6348
Gene name
LocationContig_324:122..431
Strand-
Gene length (bp)309
Transcript length (bp)309
Coding sequence length (bp)309
Protein length (aa) 103

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6282 0.4128 0.3329 0.1606 0.2841 0.0569 0.2404 0.0763 0.1446 0.0306

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7084
Change Orthofinder run
Species Protein ID
Ophiocordyceps subramaniannii Hirsu2|6348 (this protein)
Ophiocordyceps subramaniannii Hirsu2|79
Ophiocordyceps subramaniannii Hirsu2|8427

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6348
MTPDPTDQARQTPQEDEPRIPMNAAGVRWKHSRPSWPCSAPSVRPLTEKTAALFTSVHSLRFANDLSHDFLSYWD
DALNGAPTPTPISKLPPTTATETRSHW*
Coding >Hirsu2|6348
ATGACACCCGATCCCACGGATCAGGCGCGACAGACGCCTCAGGAAGACGAGCCCAGGATTCCTATGAACGCCGCA
GGAGTCAGATGGAAGCACAGCAGGCCAAGCTGGCCGTGTTCCGCGCCTTCTGTACGGCCTTTGACCGAAAAAACG
GCCGCCCTATTCACGTCGGTTCACTCGCTCCGCTTCGCCAACGACCTTTCACACGACTTTCTTAGCTACTGGGAC
GACGCGCTCAACGGCGCGCCGACGCCGACGCCGATCAGCAAATTACCACCAACCACCGCAACCGAGACCAGAAGT
CATTGGTGA
Transcript >Hirsu2|6348
ATGACACCCGATCCCACGGATCAGGCGCGACAGACGCCTCAGGAAGACGAGCCCAGGATTCCTATGAACGCCGCA
GGAGTCAGATGGAAGCACAGCAGGCCAAGCTGGCCGTGTTCCGCGCCTTCTGTACGGCCTTTGACCGAAAAAACG
GCCGCCCTATTCACGTCGGTTCACTCGCTCCGCTTCGCCAACGACCTTTCACACGACTTTCTTAGCTACTGGGAC
GACGCGCTCAACGGCGCGCCGACGCCGACGCCGATCAGCAAATTACCACCAACCACCGCAACCGAGACCAGAAGT
CATTGGTGA
Gene >Hirsu2|6348
ATGACACCCGATCCCACGGATCAGGCGCGACAGACGCCTCAGGAAGACGAGCCCAGGATTCCTATGAACGCCGCA
GGAGTCAGATGGAAGCACAGCAGGCCAAGCTGGCCGTGTTCCGCGCCTTCTGTACGGCCTTTGACCGAAAAAACG
GCCGCCCTATTCACGTCGGTTCACTCGCTCCGCTTCGCCAACGACCTTTCACACGACTTTCTTAGCTACTGGGAC
GACGCGCTCAACGGCGCGCCGACGCCGACGCCGATCAGCAAATTACCACCAACCACCGCAACCGAGACCAGAAGT
CATTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail