Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6322
Gene name
LocationContig_322:19733..20678
Strand+
Gene length (bp)945
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 2.9E-25 27 306

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2U1X8|ABNC_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnC PE=3 SV=1 29 314 3.0E-07
sp|B8NMD3|ABNC_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnC PE=3 SV=2 29 314 3.0E-07

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6322
MFSAFLVLMYRLAQLARGDTLAIDRNFPDPSIVKDRDGAWYAFATNDGERQVQVQAARATSPAGPWEVLDVDLLP
DSGGFFTGNHTWAPDVRLLDDGSYVLYFSGQVRSDPAHHCVGVAFSSRIIGPYRPRPAPLLCDLGAGGQIDPAGF
RDFDGRRYVTYKVDGNSLGRGGECNNGREPRVSTPIMLQELAANGVDKIGPPVQLLDRVGDEPLVEAPDIYRHPD
GTYFLFFSAGCFSEPDYRINYATARNVRGPYTRARSSLLSSQNTLGLVAPGGATVSGADEMPMVFHANCPAGRCM
HVQDFRVEGRRIRL*
Coding >Hirsu2|6322
ATGTTCTCGGCCTTCCTGGTGCTGATGTACCGGCTGGCGCAGCTGGCCCGGGGCGACACGCTGGCCATCGACCGA
AACTTCCCGGACCCGAGCATCGTGAAGGACCGCGACGGCGCCTGGTACGCCTTCGCGACCAACGACGGCGAGCGG
CAGGTGCAGGTGCAGGCGGCGCGGGCGACGTCGCCGGCCGGGCCGTGGGAGGTGCTCGACGTCGACCTGCTGCCG
GACTCGGGCGGCTTCTTCACCGGCAACCACACGTGGGCGCCCGACGTGCGGCTGCTGGACGACGGCTCGTACGTG
CTCTACTTCAGCGGGCAGGTCCGGTCGGACCCGGCCCACCACTGCGTCGGCGTCGCCTTCAGCTCGCGCATCATC
GGCCCGTACCGGCCGCGCCCGGCGCCGCTGCTGTGCGACCTCGGCGCCGGCGGCCAGATCGACCCGGCCGGCTTC
CGCGACTTCGACGGCCGCCGCTACGTCACTTACAAGGTCGACGGCAACAGCCTCGGCCGCGGCGGCGAGTGCAAC
AACGGCCGCGAGCCGCGCGTGTCCACGCCCATCATGCTGCAGGAGCTGGCCGCCAACGGCGTCGACAAGATCGGC
CCGCCCGTCCAGCTGCTCGACCGCGTCGGCGACGAGCCGCTCGTCGAGGCCCCCGACATCTACCGCCACCCCGAC
GGCACCTACTTCCTCTTCTTCAGCGCCGGCTGCTTCTCCGAGCCCGACTACCGCATCAACTACGCCACCGCCCGC
AACGTCCGCGGCCCCTACACCCGCGCCCGCAGCTCCCTGCTGTCCTCCCAGAACACGCTCGGCCTCGTCGCCCCC
GGCGGCGCCACCGTCTCCGGCGCCGACGAGATGCCCATGGTCTTCCATGCCAACTGTCCTGCCGGCCGCTGCATG
CACGTCCAAGACTTCCGCGTCGAGGGCAGGAGAATAAGACTATAA
Transcript >Hirsu2|6322
ATGTTCTCGGCCTTCCTGGTGCTGATGTACCGGCTGGCGCAGCTGGCCCGGGGCGACACGCTGGCCATCGACCGA
AACTTCCCGGACCCGAGCATCGTGAAGGACCGCGACGGCGCCTGGTACGCCTTCGCGACCAACGACGGCGAGCGG
CAGGTGCAGGTGCAGGCGGCGCGGGCGACGTCGCCGGCCGGGCCGTGGGAGGTGCTCGACGTCGACCTGCTGCCG
GACTCGGGCGGCTTCTTCACCGGCAACCACACGTGGGCGCCCGACGTGCGGCTGCTGGACGACGGCTCGTACGTG
CTCTACTTCAGCGGGCAGGTCCGGTCGGACCCGGCCCACCACTGCGTCGGCGTCGCCTTCAGCTCGCGCATCATC
GGCCCGTACCGGCCGCGCCCGGCGCCGCTGCTGTGCGACCTCGGCGCCGGCGGCCAGATCGACCCGGCCGGCTTC
CGCGACTTCGACGGCCGCCGCTACGTCACTTACAAGGTCGACGGCAACAGCCTCGGCCGCGGCGGCGAGTGCAAC
AACGGCCGCGAGCCGCGCGTGTCCACGCCCATCATGCTGCAGGAGCTGGCCGCCAACGGCGTCGACAAGATCGGC
CCGCCCGTCCAGCTGCTCGACCGCGTCGGCGACGAGCCGCTCGTCGAGGCCCCCGACATCTACCGCCACCCCGAC
GGCACCTACTTCCTCTTCTTCAGCGCCGGCTGCTTCTCCGAGCCCGACTACCGCATCAACTACGCCACCGCCCGC
AACGTCCGCGGCCCCTACACCCGCGCCCGCAGCTCCCTGCTGTCCTCCCAGAACACGCTCGGCCTCGTCGCCCCC
GGCGGCGCCACCGTCTCCGGCGCCGACGAGATGCCCATGGTCTTCCATGCCAACTGTCCTGCCGGCCGCTGCATG
CACGTCCAAGACTTCCGCGTCGAGGGCAGGAGAATAAGACTATAA
Gene >Hirsu2|6322
ATGTTCTCGGCCTTCCTGGTGCTGATGTACCGGCTGGCGCAGCTGGCCCGGGGCGACACGCTGGCCATCGACCGA
AACTTCCCGGACCCGAGCATCGTGAAGGACCGCGACGGCGCCTGGTACGCCTTCGCGACCAACGACGGCGAGCGG
CAGGTGCAGGTGCAGGCGGCGCGGGCGACGTCGCCGGCCGGGCCGTGGGAGGTGCTCGACGTCGACCTGCTGCCG
GACTCGGGCGGCTTCTTCACCGGCAACCACACGTGGGCGCCCGACGTGCGGCTGCTGGACGACGGCTCGTACGTG
CTCTACTTCAGCGGGCAGGTCCGGTCGGACCCGGCCCACCACTGCGTCGGCGTCGCCTTCAGCTCGCGCATCATC
GGCCCGTACCGGCCGCGCCCGGCGCCGCTGCTGTGCGACCTCGGCGCCGGCGGCCAGATCGACCCGGCCGGCTTC
CGCGACTTCGACGGCCGCCGCTACGTCACTTACAAGGTCGACGGCAACAGCCTCGGCCGCGGCGGCGAGTGCAAC
AACGGCCGCGAGCCGCGCGTGTCCACGCCCATCATGCTGCAGGAGCTGGCCGCCAACGGCGTCGACAAGATCGGC
CCGCCCGTCCAGCTGCTCGACCGCGTCGGCGACGAGCCGCTCGTCGAGGCCCCCGACATCTACCGCCACCCCGAC
GGCACCTACTTCCTCTTCTTCAGCGCCGGCTGCTTCTCCGAGCCCGACTACCGCATCAACTACGCCACCGCCCGC
AACGTCCGCGGCCCCTACACCCGCGCCCGCAGCTCCCTGCTGTCCTCCCAGAACACGCTCGGCCTCGTCGCCCCC
GGCGGCGCCACCGTCTCCGGCGCCGACGAGATGCCCATGGTCTTCCATGCCAACTGTCCTGCCGGCCGCTGCATG
CACGTCCAAGACTTCCGCGTCGAGGGCAGGAGAATAAGACTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail