Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6322
Gene name
LocationContig_322:19733..20678
Strand+
Gene length (bp)945
Transcript length (bp)945
Coding sequence length (bp)945
Protein length (aa) 315

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04616 Glyco_hydro_43 Glycosyl hydrolases family 43 3.2E-25 27 306

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q2U1X8|ABNC_ASPOR Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=abnC PE=3 SV=1 29 314 3.0E-07
sp|B8NMD3|ABNC_ASPFN Probable arabinan endo-1,5-alpha-L-arabinosidase C OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=abnC PE=3 SV=2 29 314 3.0E-07

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0071704 organic substance metabolic process No
GO:0008152 metabolic process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1576 0.0826 0.9296 0.1828 0.1275 0.1116 0.4548 0.381 0.1492 0.0313

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.67974

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH43_30 3.0E-88 26 302

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5465
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01656
Ophiocordyceps camponoti-rufipedis Ophun1|2989
Ophiocordyceps kimflemingae Ophio5|2133
Ophiocordyceps subramaniannii Hirsu2|6322 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6322
MFSAFLVLMYRLAQLARGDTLAIDRNFPDPSIVKDRDGAWYAFATNDGERQVQVQAARATSPAGPWEVLDVDLLP
DSGGFFTGNHTWAPDVRLLDDGSYVLYFSGQVRSDPAHHCVGVAFSSRIIGPYRPRPAPLLCDLGAGGQIDPAGF
RDFDGRRYVTYKVDGNSLGRGGECNNGREPRVSTPIMLQELAANGVDKIGPPVQLLDRVGDEPLVEAPDIYRHPD
GTYFLFFSAGCFSEPDYRINYATARNVRGPYTRARSSLLSSQNTLGLVAPGGATVSGADEMPMVFHANCPAGRCM
HVQDFRVEGRRIRL*
Coding >Hirsu2|6322
ATGTTCTCGGCCTTCCTGGTGCTGATGTACCGGCTGGCGCAGCTGGCCCGGGGCGACACGCTGGCCATCGACCGA
AACTTCCCGGACCCGAGCATCGTGAAGGACCGCGACGGCGCCTGGTACGCCTTCGCGACCAACGACGGCGAGCGG
CAGGTGCAGGTGCAGGCGGCGCGGGCGACGTCGCCGGCCGGGCCGTGGGAGGTGCTCGACGTCGACCTGCTGCCG
GACTCGGGCGGCTTCTTCACCGGCAACCACACGTGGGCGCCCGACGTGCGGCTGCTGGACGACGGCTCGTACGTG
CTCTACTTCAGCGGGCAGGTCCGGTCGGACCCGGCCCACCACTGCGTCGGCGTCGCCTTCAGCTCGCGCATCATC
GGCCCGTACCGGCCGCGCCCGGCGCCGCTGCTGTGCGACCTCGGCGCCGGCGGCCAGATCGACCCGGCCGGCTTC
CGCGACTTCGACGGCCGCCGCTACGTCACTTACAAGGTCGACGGCAACAGCCTCGGCCGCGGCGGCGAGTGCAAC
AACGGCCGCGAGCCGCGCGTGTCCACGCCCATCATGCTGCAGGAGCTGGCCGCCAACGGCGTCGACAAGATCGGC
CCGCCCGTCCAGCTGCTCGACCGCGTCGGCGACGAGCCGCTCGTCGAGGCCCCCGACATCTACCGCCACCCCGAC
GGCACCTACTTCCTCTTCTTCAGCGCCGGCTGCTTCTCCGAGCCCGACTACCGCATCAACTACGCCACCGCCCGC
AACGTCCGCGGCCCCTACACCCGCGCCCGCAGCTCCCTGCTGTCCTCCCAGAACACGCTCGGCCTCGTCGCCCCC
GGCGGCGCCACCGTCTCCGGCGCCGACGAGATGCCCATGGTCTTCCATGCCAACTGTCCTGCCGGCCGCTGCATG
CACGTCCAAGACTTCCGCGTCGAGGGCAGGAGAATAAGACTATAA
Transcript >Hirsu2|6322
ATGTTCTCGGCCTTCCTGGTGCTGATGTACCGGCTGGCGCAGCTGGCCCGGGGCGACACGCTGGCCATCGACCGA
AACTTCCCGGACCCGAGCATCGTGAAGGACCGCGACGGCGCCTGGTACGCCTTCGCGACCAACGACGGCGAGCGG
CAGGTGCAGGTGCAGGCGGCGCGGGCGACGTCGCCGGCCGGGCCGTGGGAGGTGCTCGACGTCGACCTGCTGCCG
GACTCGGGCGGCTTCTTCACCGGCAACCACACGTGGGCGCCCGACGTGCGGCTGCTGGACGACGGCTCGTACGTG
CTCTACTTCAGCGGGCAGGTCCGGTCGGACCCGGCCCACCACTGCGTCGGCGTCGCCTTCAGCTCGCGCATCATC
GGCCCGTACCGGCCGCGCCCGGCGCCGCTGCTGTGCGACCTCGGCGCCGGCGGCCAGATCGACCCGGCCGGCTTC
CGCGACTTCGACGGCCGCCGCTACGTCACTTACAAGGTCGACGGCAACAGCCTCGGCCGCGGCGGCGAGTGCAAC
AACGGCCGCGAGCCGCGCGTGTCCACGCCCATCATGCTGCAGGAGCTGGCCGCCAACGGCGTCGACAAGATCGGC
CCGCCCGTCCAGCTGCTCGACCGCGTCGGCGACGAGCCGCTCGTCGAGGCCCCCGACATCTACCGCCACCCCGAC
GGCACCTACTTCCTCTTCTTCAGCGCCGGCTGCTTCTCCGAGCCCGACTACCGCATCAACTACGCCACCGCCCGC
AACGTCCGCGGCCCCTACACCCGCGCCCGCAGCTCCCTGCTGTCCTCCCAGAACACGCTCGGCCTCGTCGCCCCC
GGCGGCGCCACCGTCTCCGGCGCCGACGAGATGCCCATGGTCTTCCATGCCAACTGTCCTGCCGGCCGCTGCATG
CACGTCCAAGACTTCCGCGTCGAGGGCAGGAGAATAAGACTATAA
Gene >Hirsu2|6322
ATGTTCTCGGCCTTCCTGGTGCTGATGTACCGGCTGGCGCAGCTGGCCCGGGGCGACACGCTGGCCATCGACCGA
AACTTCCCGGACCCGAGCATCGTGAAGGACCGCGACGGCGCCTGGTACGCCTTCGCGACCAACGACGGCGAGCGG
CAGGTGCAGGTGCAGGCGGCGCGGGCGACGTCGCCGGCCGGGCCGTGGGAGGTGCTCGACGTCGACCTGCTGCCG
GACTCGGGCGGCTTCTTCACCGGCAACCACACGTGGGCGCCCGACGTGCGGCTGCTGGACGACGGCTCGTACGTG
CTCTACTTCAGCGGGCAGGTCCGGTCGGACCCGGCCCACCACTGCGTCGGCGTCGCCTTCAGCTCGCGCATCATC
GGCCCGTACCGGCCGCGCCCGGCGCCGCTGCTGTGCGACCTCGGCGCCGGCGGCCAGATCGACCCGGCCGGCTTC
CGCGACTTCGACGGCCGCCGCTACGTCACTTACAAGGTCGACGGCAACAGCCTCGGCCGCGGCGGCGAGTGCAAC
AACGGCCGCGAGCCGCGCGTGTCCACGCCCATCATGCTGCAGGAGCTGGCCGCCAACGGCGTCGACAAGATCGGC
CCGCCCGTCCAGCTGCTCGACCGCGTCGGCGACGAGCCGCTCGTCGAGGCCCCCGACATCTACCGCCACCCCGAC
GGCACCTACTTCCTCTTCTTCAGCGCCGGCTGCTTCTCCGAGCCCGACTACCGCATCAACTACGCCACCGCCCGC
AACGTCCGCGGCCCCTACACCCGCGCCCGCAGCTCCCTGCTGTCCTCCCAGAACACGCTCGGCCTCGTCGCCCCC
GGCGGCGCCACCGTCTCCGGCGCCGACGAGATGCCCATGGTCTTCCATGCCAACTGTCCTGCCGGCCGCTGCATG
CACGTCCAAGACTTCCGCGTCGAGGGCAGGAGAATAAGACTATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail