Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6317
Gene name
LocationContig_322:1120..2849
Strand+
Gene length (bp)1729
Transcript length (bp)1467
Coding sequence length (bp)1467
Protein length (aa) 489

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14031 D-ser_dehydrat Putative serine dehydratase domain 1.4E-22 342 467
PF01168 Ala_racemase_N Alanine racemase, N-terminal domain 4.5E-14 33 260

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9US35|DSD1_SCHPO D-serine dehydratase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.06 PE=3 SV=1 4 488 9.0E-62
sp|P53095|DSD1_YEAST D-serine dehydratase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSD1 PE=1 SV=2 13 488 6.0E-47
sp|B2DFG5|DTHAD_DELSH D-threo-3-hydroxyaspartate dehydratase OS=Delftia sp. (strain HT23) GN=dthadh PE=1 SV=1 25 488 4.0E-18

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6317
MEAFYPTSPKEALVAAYVGQSIRHLPTPAVVLNVAAARRNCQRMLQACDKLRLGWRAHVKTHKTVELARLQVGTD
AGRPVNLIVSTLAEAEFLLPALKEYRRQGRPVNVLYGLPIAQNAVPRLAAVAQALGPGSISVLLDDPDQVPLLSR
LHEQSGGLAPHAHIKIDMGGRRAGVAADGPRFLQVAEAALEAHARGHALLSGLYSHAGHSYGGDSRVAAVRMMKD
EVAAMLAGADRLRARAADLPVLTLSAGASPTALSVQNIVVANGEDEGQDGARPDTAAATTTENELRTEAASLSAL
FDSVKARGHAVEIHAGVYPTLDLQQLAAHSLSSSRLSWTDLALTVLAEVHSVYPGRGAGGTPEALIGAGGLALGR
EPCKAYDGMAMLTPWGRPGVAMPDGDVEHFRGWIVGRFSQEHGILTWRAPPGGSQAAEPSPDRGMVQVGQKVRLW
PNHACITSSHFGWYFVVDEDRAGREDEIVDVWIRAKGW*
Coding >Hirsu2|6317
ATGGAGGCCTTCTACCCGACGTCGCCCAAGGAGGCGCTGGTGGCGGCCTACGTCGGCCAGTCCATCCGCCACCTC
CCGACGCCCGCCGTCGTCCTCAACGTCGCCGCCGCCCGCCGCAACTGCCAGCGGATGCTGCAGGCCTGCGACAAG
CTTCGGCTGGGATGGAGAGCCCATGTCAAGACGCACAAGACTGTCGAACTGGCTCGGCTCCAGGTCGGCACCGAC
GCCGGCCGACCCGTCAACCTCATCGTCTCTACCCTGGCCGAGGCCGAGTTCCTTCTGCCCGCCCTGAAGGAGTAC
CGGCGGCAGGGCAGGCCGGTCAACGTCCTGTACGGGCTGCCCATCGCGCAGAACGCCGTGCCCCGGCTGGCGGCC
GTCGCCCAGGCCCTGGGCCCGGGGAGCATCTCCGTCCTGCTCGACGACCCTGACCAGGTGCCGCTGCTGTCCCGC
CTCCACGAGCAGTCGGGCGGCCTGGCGCCGCATGCCCATATCAAGATCGACATGGGCGGTCGCCGTGCCGGCGTC
GCCGCCGACGGCCCACGCTTCCTCCAAGTCGCCGAGGCCGCCCTCGAGGCTCACGCCCGCGGCCACGCCCTCCTC
TCCGGCCTCTACTCGCACGCCGGCCACTCGTACGGCGGCGACAGCCGCGTCGCCGCCGTCCGCATGATGAAGGAC
GAAGTCGCTGCCATGCTGGCCGGAGCCGATCGGCTGCGGGCCCGCGCCGCCGACCTCCCCGTCCTGACCTTGTCG
GCCGGGGCGTCGCCGACCGCCCTGTCGGTGCAGAACATTGTTGTCGCCAACGGCGAGGACGAGGGACAAGACGGG
GCCCGGCCGGACACGGCGGCGGCGACGACGACGGAGAACGAGCTGCGGACCGAGGCGGCCTCCCTGTCAGCCCTC
TTCGATTCGGTCAAGGCCCGCGGCCACGCCGTCGAGATCCACGCGGGCGTCTACCCGACGCTGGACCTGCAGCAG
CTGGCCGCCCACAGCCTGTCGTCCTCGCGCCTCTCCTGGACCGACCTGGCGCTGACGGTCCTGGCCGAGGTGCAC
AGCGTCTATCCGGGCCGCGGCGCCGGCGGCACGCCCGAGGCCCTCATCGGCGCCGGCGGCCTGGCTCTCGGCCGC
GAGCCCTGCAAGGCCTACGACGGCATGGCCATGCTGACGCCGTGGGGGAGGCCCGGCGTCGCCATGCCCGACGGC
GACGTCGAGCACTTCCGCGGCTGGATCGTCGGCCGCTTCTCGCAGGAGCACGGCATCCTGACCTGGAGGGCGCCG
CCGGGCGGGAGCCAGGCGGCCGAGCCGTCGCCGGACCGCGGCATGGTCCAGGTCGGCCAGAAGGTCAGGCTCTGG
CCCAACCACGCCTGCATCACCAGCAGCCACTTCGGCTGGTACTTCGTCGTCGACGAGGACCGGGCCGGCAGGGAG
GACGAGATCGTCGACGTCTGGATCCGCGCCAAGGGCTGGTAA
Transcript >Hirsu2|6317
ATGGAGGCCTTCTACCCGACGTCGCCCAAGGAGGCGCTGGTGGCGGCCTACGTCGGCCAGTCCATCCGCCACCTC
CCGACGCCCGCCGTCGTCCTCAACGTCGCCGCCGCCCGCCGCAACTGCCAGCGGATGCTGCAGGCCTGCGACAAG
CTTCGGCTGGGATGGAGAGCCCATGTCAAGACGCACAAGACTGTCGAACTGGCTCGGCTCCAGGTCGGCACCGAC
GCCGGCCGACCCGTCAACCTCATCGTCTCTACCCTGGCCGAGGCCGAGTTCCTTCTGCCCGCCCTGAAGGAGTAC
CGGCGGCAGGGCAGGCCGGTCAACGTCCTGTACGGGCTGCCCATCGCGCAGAACGCCGTGCCCCGGCTGGCGGCC
GTCGCCCAGGCCCTGGGCCCGGGGAGCATCTCCGTCCTGCTCGACGACCCTGACCAGGTGCCGCTGCTGTCCCGC
CTCCACGAGCAGTCGGGCGGCCTGGCGCCGCATGCCCATATCAAGATCGACATGGGCGGTCGCCGTGCCGGCGTC
GCCGCCGACGGCCCACGCTTCCTCCAAGTCGCCGAGGCCGCCCTCGAGGCTCACGCCCGCGGCCACGCCCTCCTC
TCCGGCCTCTACTCGCACGCCGGCCACTCGTACGGCGGCGACAGCCGCGTCGCCGCCGTCCGCATGATGAAGGAC
GAAGTCGCTGCCATGCTGGCCGGAGCCGATCGGCTGCGGGCCCGCGCCGCCGACCTCCCCGTCCTGACCTTGTCG
GCCGGGGCGTCGCCGACCGCCCTGTCGGTGCAGAACATTGTTGTCGCCAACGGCGAGGACGAGGGACAAGACGGG
GCCCGGCCGGACACGGCGGCGGCGACGACGACGGAGAACGAGCTGCGGACCGAGGCGGCCTCCCTGTCAGCCCTC
TTCGATTCGGTCAAGGCCCGCGGCCACGCCGTCGAGATCCACGCGGGCGTCTACCCGACGCTGGACCTGCAGCAG
CTGGCCGCCCACAGCCTGTCGTCCTCGCGCCTCTCCTGGACCGACCTGGCGCTGACGGTCCTGGCCGAGGTGCAC
AGCGTCTATCCGGGCCGCGGCGCCGGCGGCACGCCCGAGGCCCTCATCGGCGCCGGCGGCCTGGCTCTCGGCCGC
GAGCCCTGCAAGGCCTACGACGGCATGGCCATGCTGACGCCGTGGGGGAGGCCCGGCGTCGCCATGCCCGACGGC
GACGTCGAGCACTTCCGCGGCTGGATCGTCGGCCGCTTCTCGCAGGAGCACGGCATCCTGACCTGGAGGGCGCCG
CCGGGCGGGAGCCAGGCGGCCGAGCCGTCGCCGGACCGCGGCATGGTCCAGGTCGGCCAGAAGGTCAGGCTCTGG
CCCAACCACGCCTGCATCACCAGCAGCCACTTCGGCTGGTACTTCGTCGTCGACGAGGACCGGGCCGGCAGGGAG
GACGAGATCGTCGACGTCTGGATCCGCGCCAAGGGCTGGTAA
Gene >Hirsu2|6317
ATGGAGGCCTTCTACCCGACGTCGCCCAAGGAGGCGCTGGTGGCGGCCTACGTCGGCCAGTCCATCCGCCACCTC
CCGACGCCCGCCGTCGTCCTCAACGTCGCCGCCGCCCGCCGCAACTGCCAGCGGATGCTGCAGGCCTGCGACAAG
CTTCGGCTGGGATGGAGAGCCCATGTCAAGACGCACAAGGTCGCCCTCTCCGAACTCTTGCCCCCCCCCCCCCCC
TTTTCTGTTTTTCCCTCCCCGATCCTTCGCCGGCTCTGTCCCCCACCGAGAGCTGACCGGTTCGCGCGCGCACAT
ACATGCGGTGCATCTATATGTGCGTGTACGAAAACAATCACAGACTGTCGAACTGGCTCGGCTCCAGGTCGGCAC
CGACGCCGGCCGACCCGTCAACCTCATCGTCTCTACCCTGGCCGAGGCCGAGTTCCTTCTGCCCGCCCTGAAGGA
GTACCGGCGGCAGGGCAGGCCGGTCAACGTACGTACCACGGGCCCACGGCGCCGGACGGCAAATGGGGGTCTGCT
GAGGAGACACGGGGGAGGGGGAGGGGGAGGGGGAGGGGGGCCATGCTAACGAGCCCCCCAGGTCCTGTACGGGCT
GCCCATCGCGCAGAACGCCGTGCCCCGGCTGGCGGCCGTCGCCCAGGCCCTGGGCCCGGGGAGCATCTCCGTCCT
GCTCGACGACCCTGACCAGGTGCCGCTGCTGTCCCGCCTCCACGAGCAGTCGGGCGGCCTGGCGCCGCATGCCCA
TATCAAGATCGACATGGGCGGTCGCCGTGCCGGCGTCGCCGCCGACGGCCCACGCTTCCTCCAAGTCGCCGAGGC
CGCCCTCGAGGCTCACGCCCGCGGCCACGCCCTCCTCTCCGGCCTCTACTCGCACGCCGGCCACTCGTACGGCGG
CGACAGCCGCGTCGCCGCCGTCCGCATGATGAAGGACGAAGTCGCTGCCATGCTGGCCGGAGCCGATCGGCTGCG
GGCCCGCGCCGCCGACCTCCCCGTCCTGACCTTGTCGGCCGGGGCGTCGCCGACCGCCCTGTCGGTGCAGAACAT
TGTTGTCGCCAACGGCGAGGACGAGGGACAAGACGGGGCCCGGCCGGACACGGCGGCGGCGACGACGACGGAGAA
CGAGCTGCGGACCGAGGCGGCCTCCCTGTCAGCCCTCTTCGATTCGGTCAAGGCCCGCGGCCACGCCGTCGAGAT
CCACGCGGGCGTCTACCCGACGCTGGACCTGCAGCAGCTGGCCGCCCACAGCCTGTCGTCCTCGCGCCTCTCCTG
GACCGACCTGGCGCTGACGGTCCTGGCCGAGGTGCACAGCGTCTATCCGGGCCGCGGCGCCGGCGGCACGCCCGA
GGCCCTCATCGGCGCCGGCGGCCTGGCTCTCGGCCGCGAGCCCTGCAAGGCCTACGACGGCATGGCCATGCTGAC
GCCGTGGGGGAGGCCCGGCGTCGCCATGCCCGACGGCGACGTCGAGCACTTCCGCGGCTGGATCGTCGGCCGCTT
CTCGCAGGAGCACGGCATCCTGACCTGGAGGGCGCCGCCGGGCGGGAGCCAGGCGGCCGAGCCGTCGCCGGACCG
CGGCATGGTCCAGGTCGGCCAGAAGGTCAGGCTCTGGCCCAACCACGCCTGCATCACCAGCAGCCACTTCGGCTG
GTACTTCGTCGTCGACGAGGACCGGGCCGGCAGGGAGGACGAGATCGTCGACGTCTGGATCCGCGCCAAGGGCTG
GTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail