Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6311
Gene name
LocationContig_3213:290..845
Strand-
Gene length (bp)555
Transcript length (bp)405
Coding sequence length (bp)405
Protein length (aa) 135

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03367 zf-ZPR1 ZPR1 zinc-finger domain 1.3E-30 55 132

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53303|ZPR1_YEAST Zinc finger protein ZPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZPR1 PE=1 SV=1 11 132 9.0E-32
sp|O75312|ZPR1_HUMAN Zinc finger protein ZPR1 OS=Homo sapiens GN=ZPR1 PE=1 SV=1 44 132 1.0E-28
sp|Q2TBX0|ZPR1_BOVIN Zinc finger protein ZPR1 OS=Bos taurus GN=ZNF259 PE=2 SV=1 44 132 2.0E-28
sp|Q62384|ZPR1_MOUSE Zinc finger protein ZPR1 OS=Mus musculus GN=Zpr1 PE=1 SV=1 44 132 5.0E-28
sp|A9CB27|ZPR1_PAPAN Zinc finger protein ZPR1 OS=Papio anubis GN=ZNF259 PE=3 SV=1 44 132 1.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53303|ZPR1_YEAST Zinc finger protein ZPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZPR1 PE=1 SV=1 11 132 9.0E-32
sp|O75312|ZPR1_HUMAN Zinc finger protein ZPR1 OS=Homo sapiens GN=ZPR1 PE=1 SV=1 44 132 1.0E-28
sp|Q2TBX0|ZPR1_BOVIN Zinc finger protein ZPR1 OS=Bos taurus GN=ZNF259 PE=2 SV=1 44 132 2.0E-28
sp|Q62384|ZPR1_MOUSE Zinc finger protein ZPR1 OS=Mus musculus GN=Zpr1 PE=1 SV=1 44 132 5.0E-28
sp|A9CB27|ZPR1_PAPAN Zinc finger protein ZPR1 OS=Papio anubis GN=ZNF259 PE=3 SV=1 44 132 1.0E-27
sp|O13724|ZPR1_SCHPO Zinc finger protein zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zpr1 PE=3 SV=1 23 131 2.0E-27
sp|O16999|ZPR1_CAEEL Zinc finger protein ZPR1 homolog OS=Caenorhabditis elegans GN=W03F9.1 PE=3 SV=2 45 133 4.0E-19
sp|Q55E13|ZPR1_DICDI Zinc finger protein ZPR1 homolog OS=Dictyostelium discoideum GN=zpr1 PE=3 SV=1 50 131 1.0E-18
sp|Q55E13|ZPR1_DICDI Zinc finger protein ZPR1 homolog OS=Dictyostelium discoideum GN=zpr1 PE=3 SV=1 41 131 8.0E-16
sp|O13724|ZPR1_SCHPO Zinc finger protein zpr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zpr1 PE=3 SV=1 23 132 9.0E-14
sp|O75312|ZPR1_HUMAN Zinc finger protein ZPR1 OS=Homo sapiens GN=ZPR1 PE=1 SV=1 57 132 2.0E-12
sp|Q62384|ZPR1_MOUSE Zinc finger protein ZPR1 OS=Mus musculus GN=Zpr1 PE=1 SV=1 57 132 2.0E-12
sp|A9CB27|ZPR1_PAPAN Zinc finger protein ZPR1 OS=Papio anubis GN=ZNF259 PE=3 SV=1 57 132 2.0E-12
sp|Q2TBX0|ZPR1_BOVIN Zinc finger protein ZPR1 OS=Bos taurus GN=ZNF259 PE=2 SV=1 57 132 6.0E-12
sp|O16999|ZPR1_CAEEL Zinc finger protein ZPR1 homolog OS=Caenorhabditis elegans GN=W03F9.1 PE=3 SV=2 34 128 2.0E-11
sp|P53303|ZPR1_YEAST Zinc finger protein ZPR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZPR1 PE=1 SV=1 50 128 6.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0046914 transition metal ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6311
MQSNDTKGDTTQKPTEFFESIGDKVEGLASATNGAAAAAAAGDEDDYRPVEEVESLCMNCGKNGMTRLLLTAIPY
FREVVIMSFACEHCNTRNNEIQAAGTVQAKGTHYELRLTSLADLGRQVVKSDTAVVKAC*
Coding >Hirsu2|6311
ATGCAGTCCAACGACACAAAGGGCGACACGACGCAGAAGCCGACCGAGTTCTTCGAATCGATCGGCGACAAGGTC
GAGGGCCTGGCATCGGCGACTAATGGCGCCGCCGCCGCCGCCGCCGCAGGCGACGAGGACGACTACAGGCCGGTC
GAGGAGGTCGAGTCGCTGTGCATGAACTGCGGGAAGAATGGCATGACGCGACTGCTCCTGACGGCGATACCGTAC
TTCCGCGAAGTGGTCATCATGTCGTTCGCGTGCGAGCACTGCAACACGCGCAACAACGAGATCCAGGCGGCCGGC
ACGGTGCAGGCCAAGGGGACGCACTACGAGCTGCGGCTGACGTCGCTGGCGGACCTGGGCCGGCAGGTGGTCAAG
TCGGACACGGCCGTCGTCAAGGCCTGCTGA
Transcript >Hirsu2|6311
ATGCAGTCCAACGACACAAAGGGCGACACGACGCAGAAGCCGACCGAGTTCTTCGAATCGATCGGCGACAAGGTC
GAGGGCCTGGCATCGGCGACTAATGGCGCCGCCGCCGCCGCCGCCGCAGGCGACGAGGACGACTACAGGCCGGTC
GAGGAGGTCGAGTCGCTGTGCATGAACTGCGGGAAGAATGGCATGACGCGACTGCTCCTGACGGCGATACCGTAC
TTCCGCGAAGTGGTCATCATGTCGTTCGCGTGCGAGCACTGCAACACGCGCAACAACGAGATCCAGGCGGCCGGC
ACGGTGCAGGCCAAGGGGACGCACTACGAGCTGCGGCTGACGTCGCTGGCGGACCTGGGCCGGCAGGTGGTCAAG
TCGGACACGGCCGTCGTCAAGGCCTGCTGA
Gene >Hirsu2|6311
ATGCAGTCCAACGACACAAAGGGCGACACGACGCAGAAGCCGACCGAGTTCTTCGAATCGATCGGCGACAAGGTC
GAGGGCCTGGCATCGGCGACTAATGGCGCCGCCGCCGCCGCCGCCGCAGGCGACGAGGACGACTACAGGCCGGTC
GAGGAGGTCGAGTCGCTGTGCATGAACTGCGGGAAGAATGTGAGTCGAGATGGCCGGGGCGTGTCGGATCCGCCC
GTCGCCCGTCGGCGTCTTGTGCCGCCGCTGACCCGTCTTGCGTGGCGGCAACGCAGGGCATGACGCGACTGCTCC
TGACGGCGATACCGTACTTCCGCGAAGTGGTCATCATGTCGTTCGCGTGCGAGCACTGCAACACGCGCAACAACG
AGATCCAGGCGGCCGGCACGGTGCAGGCCAAGGGGACGCACTACGAGCTGCGGCTGACGTCGCTGGCGGACCTGG
GCCGGCAGGTGGTCAAGTCGGACACGGCCGTCGTCAAGTTCATCGAGCTGGACCTCGAGATCCCGGCCGGGCGCG
GGCAGCTGACCAACGTCGAGGGCCTGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail