Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6307
Gene name
LocationContig_321:19700..21053
Strand-
Gene length (bp)1353
Transcript length (bp)1284
Coding sequence length (bp)1284
Protein length (aa) 428

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 144 166 22
2 176 195 19
3 216 238 22
4 253 275 22
5 336 358 22
6 362 384 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6307
MPEVRRGSACDPTPPWTAEDGANVDSSFSHGGHDEEKRADGSGGDGRPPGRVGVLTPDEDDELRRHRSHHHPPPQ
YGARASMEPRRSLSYALRPTAEVYYDSRAATRSEWRRRAMTLDEYYDDNPHLLPQLPFTWHHGRRRWRLWFFAFL
AFVDASAVPIALYYGMRYAGHVEGWIIFAVVTSIWGGPTYVEFGVRTLRLVRRERFYRPLGTDGRWCFDMLNWAS
VLTITAVTALFIVGSAPHNVWLRVLCMPAPAILYCLGGVLALLTLFHATGCPAPCRISSTARGEKVLPGAYYFVE
DVVAVNAGAGRPYREALAARYKASPRFRRMLYVQSLFWSVPALALAAALTVVALVHPVPATVAYGVCWAVPFLWM
AVWGVITVSWCKREMVRERVEWEAGGGTAGKGSAQEAAAEMGQVPAAASPAS*
Coding >Hirsu2|6307
ATGCCCGAGGTTCGGCGCGGAAGCGCATGTGATCCCACGCCGCCCTGGACAGCCGAGGACGGCGCCAACGTGGAC
AGCAGCTTCAGCCATGGCGGGCACGACGAGGAGAAGAGGGCGGACGGGTCGGGCGGCGACGGGCGGCCGCCCGGC
CGGGTCGGCGTGCTGACGCCGGACGAGGACGACGAGCTGCGGCGGCACCGGTCGCACCACCACCCGCCGCCGCAG
TACGGGGCGCGGGCCAGCATGGAGCCGCGGCGCAGCCTGTCGTACGCGCTGCGGCCGACGGCCGAGGTCTACTAC
GACTCGCGGGCGGCGACGCGCAGCGAGTGGCGGCGGCGGGCCATGACGCTCGACGAGTACTACGACGACAACCCG
CACCTGTTACCGCAGCTGCCCTTCACGTGGCACCACGGGCGCCGGCGCTGGCGCCTCTGGTTCTTCGCCTTCCTC
GCCTTCGTCGACGCCTCGGCCGTGCCCATCGCGCTCTACTACGGCATGCGCTACGCCGGCCACGTCGAGGGCTGG
ATCATCTTCGCCGTCGTCACCAGCATCTGGGGCGGGCCGACGTACGTCGAGTTCGGCGTCCGCACCCTGCGCCTC
GTCCGCCGCGAGCGCTTCTACCGCCCGCTCGGCACCGACGGCCGCTGGTGCTTCGACATGCTCAACTGGGCCTCG
GTCCTGACCATCACCGCCGTCACCGCCCTCTTCATCGTCGGCAGCGCCCCGCACAACGTCTGGCTGCGCGTCCTG
TGCATGCCCGCGCCCGCCATCCTCTACTGCCTCGGCGGCGTCCTGGCCCTGCTGACCCTCTTCCACGCCACCGGC
TGCCCGGCCCCCTGCCGCATCAGCTCGACGGCCCGGGGCGAAAAGGTACTGCCCGGGGCCTACTACTTCGTCGAG
GACGTGGTGGCGGTCAACGCCGGGGCCGGGCGACCCTACCGCGAGGCGCTGGCGGCGCGGTACAAGGCCAGCCCG
CGCTTCCGGCGCATGCTCTACGTGCAGTCGCTGTTCTGGTCGGTGCCGGCACTGGCGCTGGCGGCGGCGCTGACG
GTGGTGGCGCTGGTGCATCCCGTGCCGGCCACGGTCGCCTACGGCGTCTGCTGGGCGGTGCCCTTCCTGTGGATG
GCCGTCTGGGGCGTCATCACCGTCTCCTGGTGCAAGCGCGAGATGGTGAGGGAGAGGGTGGAGTGGGAGGCCGGC
GGCGGGACGGCCGGCAAGGGCAGCGCGCAGGAGGCGGCGGCGGAGATGGGCCAGGTGCCCGCCGCTGCGTCGCCG
GCTTCCTGA
Transcript >Hirsu2|6307
ATGCCCGAGGTTCGGCGCGGAAGCGCATGTGATCCCACGCCGCCCTGGACAGCCGAGGACGGCGCCAACGTGGAC
AGCAGCTTCAGCCATGGCGGGCACGACGAGGAGAAGAGGGCGGACGGGTCGGGCGGCGACGGGCGGCCGCCCGGC
CGGGTCGGCGTGCTGACGCCGGACGAGGACGACGAGCTGCGGCGGCACCGGTCGCACCACCACCCGCCGCCGCAG
TACGGGGCGCGGGCCAGCATGGAGCCGCGGCGCAGCCTGTCGTACGCGCTGCGGCCGACGGCCGAGGTCTACTAC
GACTCGCGGGCGGCGACGCGCAGCGAGTGGCGGCGGCGGGCCATGACGCTCGACGAGTACTACGACGACAACCCG
CACCTGTTACCGCAGCTGCCCTTCACGTGGCACCACGGGCGCCGGCGCTGGCGCCTCTGGTTCTTCGCCTTCCTC
GCCTTCGTCGACGCCTCGGCCGTGCCCATCGCGCTCTACTACGGCATGCGCTACGCCGGCCACGTCGAGGGCTGG
ATCATCTTCGCCGTCGTCACCAGCATCTGGGGCGGGCCGACGTACGTCGAGTTCGGCGTCCGCACCCTGCGCCTC
GTCCGCCGCGAGCGCTTCTACCGCCCGCTCGGCACCGACGGCCGCTGGTGCTTCGACATGCTCAACTGGGCCTCG
GTCCTGACCATCACCGCCGTCACCGCCCTCTTCATCGTCGGCAGCGCCCCGCACAACGTCTGGCTGCGCGTCCTG
TGCATGCCCGCGCCCGCCATCCTCTACTGCCTCGGCGGCGTCCTGGCCCTGCTGACCCTCTTCCACGCCACCGGC
TGCCCGGCCCCCTGCCGCATCAGCTCGACGGCCCGGGGCGAAAAGGTACTGCCCGGGGCCTACTACTTCGTCGAG
GACGTGGTGGCGGTCAACGCCGGGGCCGGGCGACCCTACCGCGAGGCGCTGGCGGCGCGGTACAAGGCCAGCCCG
CGCTTCCGGCGCATGCTCTACGTGCAGTCGCTGTTCTGGTCGGTGCCGGCACTGGCGCTGGCGGCGGCGCTGACG
GTGGTGGCGCTGGTGCATCCCGTGCCGGCCACGGTCGCCTACGGCGTCTGCTGGGCGGTGCCCTTCCTGTGGATG
GCCGTCTGGGGCGTCATCACCGTCTCCTGGTGCAAGCGCGAGATGGTGAGGGAGAGGGTGGAGTGGGAGGCCGGC
GGCGGGACGGCCGGCAAGGGCAGCGCGCAGGAGGCGGCGGCGGAGATGGGCCAGGTGCCCGCCGCTGCGTCGCCG
GCTTCCTGA
Gene >Hirsu2|6307
ATGCCCGAGGTTCGGCGCGGAAGCGCATGTGATCCCACGCCGCCCTGGACAGCCGAGGACGGCGCCAACGTGGAC
AGCAGCTTCAGCCATGGCGGGCACGACGAGGAGAAGAGGGCGGACGGGTCGGGCGGCGACGGGCGGCCGCCCGGC
CGGGTCGGCGTGCTGACGCCGGACGAGGACGACGAGCTGCGGCGGCACCGGTCGCACCACCACCCGCCGCCGCAG
TACGGGGCGCGGGCCAGCATGGAGCCGCGGCGCAGCCTGTCGTACGCGCTGCGGCCGACGGCCGAGGTCTACTAC
GACTCGCGGGCGGCGACGCGCAGCGAGTGGCGGCGGCGGGCCATGACGCTCGACGAGTACTACGACGACAACCCG
CACCTGTTACCGCAGCTGCCCTTCACGTGGCACCACGGGCGCCGGCGCTGGCGCCTCTGGTTCTTCGCCTTCCTC
GCCTTCGTCGACGCCTCGGCCGTGCCCATCGCGCTCTACTACGGCATGCGCTACGCCGGCCACGTCGAGGGCTGG
ATCATCTTCGCCGTCGTCACCAGCATCTGGGGCGGGCCGACGTACGTCGAGTTCGGCGTCCGCACCCTGCGCCTC
GTCCGCCGCGAGCGCTTCTACCGCCCGCTCGGCACCGACGGCCGCTGGTGCTTCGACATGCTCAACTGGGCCTCG
GTCCTGACCATCACCGCCGTCACCGCCCTCTTCATCGTCGGCAGCGCCCCGCACAACGTCTGGCTGCGCGTCCTG
TGCATGCCCGCGCCCGCCATCCTCTACTGCCTCGGCGGCGTCCTGGCCCTGCTGACCCTCTTCCACGCCACCGGC
TGCCCGGCCCCCTGCCGCATCAGCTCGACGGCCCGGGGCGAAAAGGTATGATGATGATGAACTCTGTCTCGTCCT
CCTCTCTTGGCTGACCGTCCGTGTCTCTCCCCCTTCCAGGTACTGCCCGGGGCCTACTACTTCGTCGAGGACGTG
GTGGCGGTCAACGCCGGGGCCGGGCGACCCTACCGCGAGGCGCTGGCGGCGCGGTACAAGGCCAGCCCGCGCTTC
CGGCGCATGCTCTACGTGCAGTCGCTGTTCTGGTCGGTGCCGGCACTGGCGCTGGCGGCGGCGCTGACGGTGGTG
GCGCTGGTGCATCCCGTGCCGGCCACGGTCGCCTACGGCGTCTGCTGGGCGGTGCCCTTCCTGTGGATGGCCGTC
TGGGGCGTCATCACCGTCTCCTGGTGCAAGCGCGAGATGGTGAGGGAGAGGGTGGAGTGGGAGGCCGGCGGCGGG
ACGGCCGGCAAGGGCAGCGCGCAGGAGGCGGCGGCGGAGATGGGCCAGGTGCCCGCCGCTGCGTCGCCGGCTTCC
TGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail