Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6304
Gene name
LocationContig_321:10510..11853
Strand+
Gene length (bp)1343
Transcript length (bp)1203
Coding sequence length (bp)1203
Protein length (aa) 401

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00439 Bromodomain Bromodomain 9.1E-26 297 378
PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family 1.5E-07 112 187
PF13673 Acetyltransf_10 Acetyltransferase (GNAT) domain 1.7E-06 116 189

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZM0|GCN5_YARLI Histone acetyltransferase GCN5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GCN5 PE=3 SV=1 47 396 0.0E+00
sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GCN5 PE=3 SV=1 33 396 3.0E-178
sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 47 396 1.0E-175
sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GCN5 PE=3 SV=1 47 396 9.0E-175
sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GCN5 PE=3 SV=1 30 396 6.0E-173
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8WZM0|GCN5_YARLI Histone acetyltransferase GCN5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=GCN5 PE=3 SV=1 47 396 0.0E+00
sp|Q756G9|GCN5_ASHGO Histone acetyltransferase GCN5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=GCN5 PE=3 SV=1 33 396 3.0E-178
sp|Q03330|GCN5_YEAST Histone acetyltransferase GCN5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCN5 PE=1 SV=1 47 396 1.0E-175
sp|Q6CXW4|GCN5_KLULA Histone acetyltransferase GCN5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GCN5 PE=3 SV=1 47 396 9.0E-175
sp|Q6FTW5|GCN5_CANGA Histone acetyltransferase GCN5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GCN5 PE=3 SV=1 30 396 6.0E-173
sp|Q6BGW1|GCN5_DEBHA Histone acetyltransferase GCN5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GCN5 PE=3 SV=2 47 396 1.0E-170
sp|Q9UUK2|GCN5_SCHPO Histone acetyltransferase gcn5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gcn5 PE=1 SV=1 15 396 4.0E-153
sp|Q338B9|GCN5_ORYSJ Histone acetyltransferase GCN5 OS=Oryza sativa subsp. japonica GN=GCN5 PE=2 SV=1 55 389 7.0E-100
sp|Q9AR19|GCN5_ARATH Histone acetyltransferase GCN5 OS=Arabidopsis thaliana GN=HAG1 PE=1 SV=1 55 389 2.0E-96
sp|Q92831|KAT2B_HUMAN Histone acetyltransferase KAT2B OS=Homo sapiens GN=KAT2B PE=1 SV=3 52 388 9.0E-93
sp|Q9JHD1|KAT2B_MOUSE Histone acetyltransferase KAT2B OS=Mus musculus GN=Kat2b PE=1 SV=2 52 388 1.0E-90
sp|Q92830|KAT2A_HUMAN Histone acetyltransferase KAT2A OS=Homo sapiens GN=KAT2A PE=1 SV=3 52 388 2.0E-90
sp|Q9JHD2|KAT2A_MOUSE Histone acetyltransferase KAT2A OS=Mus musculus GN=Kat2a PE=1 SV=2 52 388 2.0E-90
sp|Q12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens GN=BPTF PE=1 SV=3 291 389 1.0E-20
sp|Q9W0T1|NU301_DROME Nucleosome-remodeling factor subunit NURF301 OS=Drosophila melanogaster GN=E(bx) PE=1 SV=2 294 388 2.0E-20
sp|Q9BXF3|CECR2_HUMAN Cat eye syndrome critical region protein 2 OS=Homo sapiens GN=CECR2 PE=1 SV=2 291 381 4.0E-18
sp|Q9DE13|BAZ2B_CHICK Bromodomain adjacent to zinc finger domain protein 2B OS=Gallus gallus GN=BAZ2B PE=2 SV=1 298 387 3.0E-17
sp|Q9UIF8|BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens GN=BAZ2B PE=1 SV=3 298 383 1.0E-16
sp|A2BIL7|BAZ1B_DANRE Tyrosine-protein kinase BAZ1B OS=Danio rerio GN=baz1b PE=1 SV=2 268 396 2.0E-16
sp|B7ZS37|BAZ2A_XENLA Bromodomain adjacent to zinc finger domain protein 2A OS=Xenopus laevis GN=baz2a PE=2 SV=1 272 382 1.0E-15
sp|Q91YE5|BAZ2A_MOUSE Bromodomain adjacent to zinc finger domain protein 2A OS=Mus musculus GN=Baz2a PE=1 SV=2 298 387 4.0E-15
sp|Q9UIF9|BAZ2A_HUMAN Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens GN=BAZ2A PE=1 SV=4 298 387 5.0E-15
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 297 390 4.0E-14
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 297 390 5.0E-14
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 308 387 9.0E-14
sp|Q9Y7N0|BDF1_SCHPO SWR1 complex bromodomain subunit bdf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdf1 PE=1 SV=1 270 392 4.0E-13
sp|F1R5H6|BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio GN=brd4 PE=1 SV=1 308 392 5.0E-13
sp|Q9Y7N0|BDF1_SCHPO SWR1 complex bromodomain subunit bdf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdf1 PE=1 SV=1 285 393 7.0E-13
sp|O95696|BRD1_HUMAN Bromodomain-containing protein 1 OS=Homo sapiens GN=BRD1 PE=1 SV=1 279 379 1.0E-12
sp|Q5TJG6|BRD2_CANLF Bromodomain-containing protein 2 OS=Canis lupus familiaris GN=BRD2 PE=3 SV=1 266 392 2.0E-12
sp|Q32S26|BRD2_BOVIN Bromodomain-containing protein 2 OS=Bos taurus GN=BRD2 PE=3 SV=1 266 392 2.0E-12
sp|Q6MGA9|BRD2_RAT Bromodomain-containing protein 2 OS=Rattus norvegicus GN=Brd2 PE=1 SV=1 266 392 2.0E-12
sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus GN=Brd2 PE=1 SV=1 266 392 2.0E-12
sp|P25440|BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sapiens GN=BRD2 PE=1 SV=2 266 392 2.0E-12
sp|Q8UVR5|BAZ1A_XENLA Bromodomain adjacent to zinc finger domain protein 1A (Fragment) OS=Xenopus laevis GN=baz1a PE=2 SV=1 297 383 4.0E-12
sp|Q58F21|BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens GN=BRDT PE=1 SV=4 287 392 4.0E-12
sp|Q9Z277|BAZ1B_MOUSE Tyrosine-protein kinase BAZ1B OS=Mus musculus GN=Baz1b PE=1 SV=2 277 383 5.0E-12
sp|O15164|TIF1A_HUMAN Transcription intermediary factor 1-alpha OS=Homo sapiens GN=TRIM24 PE=1 SV=3 298 388 5.0E-12
sp|Q64127|TIF1A_MOUSE Transcription intermediary factor 1-alpha OS=Mus musculus GN=Trim24 PE=1 SV=1 298 388 5.0E-12
sp|Q9ULD4|BRPF3_HUMAN Bromodomain and PHD finger-containing protein 3 OS=Homo sapiens GN=BRPF3 PE=1 SV=2 292 379 5.0E-12
sp|P13709|FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster GN=fs(1)h PE=1 SV=2 250 392 6.0E-12
sp|Q84XV2|GTE1_ARATH Transcription factor GTE1 OS=Arabidopsis thaliana GN=GTE1 PE=2 SV=1 294 400 6.0E-12
sp|Q95Y80|BET1_CAEEL Bromodomain-containing protein bet-1 OS=Caenorhabditis elegans GN=bet-1 PE=1 SV=3 290 366 6.0E-12
sp|Q5TJG6|BRD2_CANLF Bromodomain-containing protein 2 OS=Canis lupus familiaris GN=BRD2 PE=3 SV=1 251 380 7.0E-12
sp|Q6MGA9|BRD2_RAT Bromodomain-containing protein 2 OS=Rattus norvegicus GN=Brd2 PE=1 SV=1 251 380 7.0E-12
sp|Q7JJ13|BRD2_MOUSE Bromodomain-containing protein 2 OS=Mus musculus GN=Brd2 PE=1 SV=1 251 380 7.0E-12
sp|P25440|BRD2_HUMAN Bromodomain-containing protein 2 OS=Homo sapiens GN=BRD2 PE=1 SV=2 251 380 8.0E-12
sp|Q9FGW9|GTE10_ARATH Transcription factor GTE10 OS=Arabidopsis thaliana GN=GTE10 PE=1 SV=2 298 391 8.0E-12
sp|Q32S26|BRD2_BOVIN Bromodomain-containing protein 2 OS=Bos taurus GN=BRD2 PE=3 SV=1 251 380 1.0E-11
sp|Q15059|BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens GN=BRD3 PE=1 SV=1 308 392 1.0E-11
sp|Q9UIG0|BAZ1B_HUMAN Tyrosine-protein kinase BAZ1B OS=Homo sapiens GN=BAZ1B PE=1 SV=2 278 383 1.0E-11
sp|Q08D75|BRD4A_XENLA Bromodomain-containing protein 4A OS=Xenopus laevis GN=brd4-a PE=2 SV=1 276 392 1.0E-11
sp|Q8K2F0|BRD3_MOUSE Bromodomain-containing protein 3 OS=Mus musculus GN=Brd3 PE=1 SV=2 308 392 1.0E-11
sp|F7DRV9|BRDT_XENTR Bromodomain testis-specific protein OS=Xenopus tropicalis GN=brdt PE=3 SV=1 270 391 1.0E-11
sp|F1R5H6|BRD4_DANRE Bromodomain-containing protein 4 OS=Danio rerio GN=brd4 PE=1 SV=1 273 392 2.0E-11
sp|Q4R8Y1|BRDT_MACFA Bromodomain testis-specific protein OS=Macaca fascicularis GN=BRDT PE=2 SV=3 287 392 2.0E-11
sp|Q54UW4|Y0777_DICDI Bromodomain-containing protein DDB_G0280777 OS=Dictyostelium discoideum GN=DDB_G0280777 PE=3 SV=1 253 381 2.0E-11
sp|Q15059|BRD3_HUMAN Bromodomain-containing protein 3 OS=Homo sapiens GN=BRD3 PE=1 SV=1 262 392 3.0E-11
sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens GN=BRD4 PE=1 SV=2 308 392 3.0E-11
sp|Q6DFF2|BRD4B_XENLA Bromodomain-containing protein 4B OS=Xenopus laevis GN=brd4-b PE=2 SV=1 281 392 3.0E-11
sp|Q9HGP4|YK82_SCHPO Bromodomain-containing protein C631.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC631.02 PE=1 SV=3 303 393 3.0E-11
sp|P13709|FSH_DROME Homeotic protein female sterile OS=Drosophila melanogaster GN=fs(1)h PE=1 SV=2 293 366 4.0E-11
sp|Q8H1D7|GTE5_ARATH Transcription factor GTE5, chloroplastic OS=Arabidopsis thaliana GN=GTE5 PE=1 SV=1 298 366 4.0E-11
sp|O60885|BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens GN=BRD4 PE=1 SV=2 293 391 5.0E-11
sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus GN=Brd4 PE=1 SV=2 293 391 5.0E-11
sp|Q9ESU6|BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus GN=Brd4 PE=1 SV=2 308 392 6.0E-11
sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 308 398 6.0E-11
sp|Q93YS6|GTE9_ARATH Transcription factor GTE9 OS=Arabidopsis thaliana GN=GTE9 PE=1 SV=1 294 388 6.0E-11
sp|Q8K2F0|BRD3_MOUSE Bromodomain-containing protein 3 OS=Mus musculus GN=Brd3 PE=1 SV=2 289 392 1.0E-10
sp|Q9FT54|GTE6_ARATH Transcription factor GTE6 OS=Arabidopsis thaliana GN=GTE6 PE=2 SV=1 294 382 1.0E-10
sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 308 398 1.0E-10
sp|Q9LS28|GTE12_ARATH Transcription factor GTE12 OS=Arabidopsis thaliana GN=GTE12 PE=2 SV=2 293 387 1.0E-10
sp|A8DZJ1|BAZ1B_XENLA Tyrosine-protein kinase BAZ1B OS=Xenopus laevis GN=baz1b PE=2 SV=2 278 365 1.0E-10
sp|F1QW93|BRDT_DANRE Bromodomain testis-specific protein OS=Danio rerio GN=brdt PE=3 SV=2 293 392 2.0E-10
sp|Q91Y44|BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus GN=Brdt PE=1 SV=3 265 392 2.0E-10
sp|Q93ZB7|GTE11_ARATH Transcription factor GTE11 OS=Arabidopsis thaliana GN=GTE11 PE=1 SV=1 294 388 3.0E-10
sp|Q54BA2|Y3800_DICDI Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 298 379 3.0E-10
sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens GN=TAF1L PE=1 SV=1 308 398 3.0E-10
sp|Q80UV9|TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus GN=Taf1 PE=1 SV=2 308 398 3.0E-10
sp|D4A7T3|BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus GN=Brdt PE=1 SV=1 241 366 3.0E-10
sp|Q91Y44|BRDT_MOUSE Bromodomain testis-specific protein OS=Mus musculus GN=Brdt PE=1 SV=3 308 366 5.0E-10
sp|G5EGM3|TAF1_CAEEL Transcription initiation factor TFIID subunit 1 OS=Caenorhabditis elegans GN=taf-1 PE=2 SV=1 245 379 5.0E-10
sp|D4A7T3|BRDT_RAT Bromodomain testis-specific protein OS=Rattus norvegicus GN=Brdt PE=1 SV=1 265 396 6.0E-10
sp|Q55C84|Y0170_DICDI Bromodomain-containing protein DDB_G0270170 OS=Dictyostelium discoideum GN=DDB_G0270170 PE=3 SV=1 290 400 6.0E-10
sp|Q9S7T1|GTE3_ARATH Transcription factor GTE3, chloroplastic OS=Arabidopsis thaliana GN=GTE3 PE=1 SV=1 297 366 6.0E-10
sp|Q6DFF2|BRD4B_XENLA Bromodomain-containing protein 4B OS=Xenopus laevis GN=brd4-b PE=2 SV=1 303 392 7.0E-10
sp|P55201|BRPF1_HUMAN Peregrin OS=Homo sapiens GN=BRPF1 PE=1 SV=2 295 379 7.0E-10
sp|F1QW93|BRDT_DANRE Bromodomain testis-specific protein OS=Danio rerio GN=brdt PE=3 SV=2 298 392 1.0E-09
sp|Q56R14|TRI33_XENLA E3 ubiquitin-protein ligase TRIM33 OS=Xenopus laevis GN=trim33 PE=1 SV=1 298 366 1.0E-09
sp|Q9HGP4|YK82_SCHPO Bromodomain-containing protein C631.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC631.02 PE=1 SV=3 298 391 2.0E-09
sp|Q08D75|BRD4A_XENLA Bromodomain-containing protein 4A OS=Xenopus laevis GN=brd4-a PE=2 SV=1 303 366 3.0E-09
sp|P35817|BDF1_YEAST Bromodomain-containing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDF1 PE=1 SV=3 309 383 3.0E-09
sp|Q58F21|BRDT_HUMAN Bromodomain testis-specific protein OS=Homo sapiens GN=BRDT PE=1 SV=4 308 366 4.0E-09
sp|Q5A4W8|BDF1_CANAL Bromodomain-containing factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BDF1 PE=2 SV=1 293 392 4.0E-09
sp|Q8WWQ0|PHIP_HUMAN PH-interacting protein OS=Homo sapiens GN=PHIP PE=1 SV=2 294 390 4.0E-09
sp|Q921C3|BRWD1_MOUSE Bromodomain and WD repeat-containing protein 1 OS=Mus musculus GN=Brwd1 PE=1 SV=2 310 390 4.0E-09
sp|Q4R8Y1|BRDT_MACFA Bromodomain testis-specific protein OS=Macaca fascicularis GN=BRDT PE=2 SV=3 308 366 5.0E-09
sp|Q8VDD9|PHIP_MOUSE PH-interacting protein OS=Mus musculus GN=Phip PE=1 SV=2 294 390 5.0E-09
sp|B2RWS6|EP300_MOUSE Histone acetyltransferase p300 OS=Mus musculus GN=Ep300 PE=1 SV=2 310 390 7.0E-09
sp|F7DRV9|BRDT_XENTR Bromodomain testis-specific protein OS=Xenopus tropicalis GN=brdt PE=3 SV=1 250 392 9.0E-09
sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 311 371 9.0E-09
sp|Q09472|EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens GN=EP300 PE=1 SV=2 310 390 1.0E-08
sp|P45481|CBP_MOUSE CREB-binding protein OS=Mus musculus GN=Crebbp PE=1 SV=3 310 390 1.0E-08
sp|Q6JHU9|CBP_RAT CREB-binding protein OS=Rattus norvegicus GN=Crebbp PE=1 SV=1 310 390 1.0E-08
sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREBBP PE=1 SV=3 310 390 1.0E-08
sp|Q7ZUF2|BRD9_DANRE Bromodomain-containing protein 9 OS=Danio rerio GN=brd9 PE=2 SV=1 290 379 1.0E-08
sp|Q07442|BDF2_YEAST Bromodomain-containing factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDF2 PE=1 SV=1 294 384 1.0E-08
sp|Q9UPN9|TRI33_HUMAN E3 ubiquitin-protein ligase TRIM33 OS=Homo sapiens GN=TRIM33 PE=1 SV=3 298 366 2.0E-08
sp|Q7Y214|GTE7_ARATH Transcription factor GTE7 OS=Arabidopsis thaliana GN=GTE7 PE=2 SV=1 293 366 2.0E-08
sp|Q99PP7|TRI33_MOUSE E3 ubiquitin-protein ligase TRIM33 OS=Mus musculus GN=Trim33 PE=1 SV=2 298 366 2.0E-08
sp|P51123|TAF1_DROME Transcription initiation factor TFIID subunit 1 OS=Drosophila melanogaster GN=Taf1 PE=1 SV=3 294 379 3.0E-08
sp|Q5A4W8|BDF1_CANAL Bromodomain-containing factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BDF1 PE=2 SV=1 277 391 5.0E-08
sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 311 371 5.0E-08
sp|Q86U86|PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 311 390 5.0E-08
sp|Q9NSI6|BRWD1_HUMAN Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens GN=BRWD1 PE=1 SV=4 294 390 5.0E-08
sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 311 371 5.0E-08
sp|Q9H0E9|BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens GN=BRD8 PE=1 SV=2 295 393 6.0E-08
sp|Q9LNC4|GTE4_ARATH Transcription factor GTE4 OS=Arabidopsis thaliana GN=GTE4 PE=2 SV=1 298 368 9.0E-08
sp|P35177|SPT7_YEAST Transcriptional activator SPT7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPT7 PE=1 SV=1 301 391 1.0E-07
sp|P34545|CBP1_CAEEL Protein cbp-1 OS=Caenorhabditis elegans GN=cbp-1 PE=1 SV=6 295 390 1.0E-07
sp|Q8CDM1|ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 311 371 1.0E-07
sp|Q6BER5|NU301_CAEEL Nucleosome-remodeling factor subunit NURF301-like OS=Caenorhabditis elegans GN=nurf-1 PE=1 SV=2 257 392 1.0E-07
sp|O74350|BDC1_SCHPO Bromodomain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bdc1 PE=1 SV=1 295 375 1.0E-07
sp|Q07442|BDF2_YEAST Bromodomain-containing factor 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDF2 PE=1 SV=1 306 391 2.0E-07
sp|Q6E2N3|TRI33_DANRE E3 ubiquitin-protein ligase TRIM33 OS=Danio rerio GN=trim33 PE=2 SV=1 295 366 2.0E-07
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 311 383 2.0E-07
sp|Q9LXA7|GTE2_ARATH Transcription factor GTE2 OS=Arabidopsis thaliana GN=GTE2 PE=2 SV=2 297 366 2.0E-07
sp|Q02206|RSC4_YEAST Chromatin structure-remodeling complex subunit RSC4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSC4 PE=1 SV=2 310 383 2.0E-07
sp|P35817|BDF1_YEAST Bromodomain-containing factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDF1 PE=1 SV=3 278 391 3.0E-07
sp|Q90941|PB1_CHICK Protein polybromo-1 OS=Gallus gallus GN=PBRM1 PE=1 SV=1 311 390 3.0E-07
sp|Q9LK27|GTE8_ARATH Transcription factor GTE8 OS=Arabidopsis thaliana GN=GTE8 PE=2 SV=2 298 366 3.0E-07
sp|O15016|TRI66_HUMAN Tripartite motif-containing protein 66 OS=Homo sapiens GN=TRIM66 PE=2 SV=4 310 392 3.0E-07
sp|Q924W6|TRI66_MOUSE Tripartite motif-containing protein 66 OS=Mus musculus GN=Trim66 PE=1 SV=3 310 390 4.0E-07
sp|Q6GLP7|BRD9_XENLA Bromodomain-containing protein 9 OS=Xenopus laevis GN=brd9 PE=2 SV=1 294 379 5.0E-07
sp|Q9H8M2|BRD9_HUMAN Bromodomain-containing protein 9 OS=Homo sapiens GN=BRD9 PE=1 SV=2 294 379 7.0E-07
sp|Q3UQU0|BRD9_MOUSE Bromodomain-containing protein 9 OS=Mus musculus GN=Brd9 PE=1 SV=1 295 379 7.0E-07
sp|Q95Y80|BET1_CAEEL Bromodomain-containing protein bet-1 OS=Caenorhabditis elegans GN=bet-1 PE=1 SV=3 295 395 1.0E-06
sp|Q6NVM8|BRD9_XENTR Bromodomain-containing protein 9 OS=Xenopus tropicalis GN=brd9 PE=2 SV=1 294 379 1.0E-06
sp|Q60544|TAF1_MESAU Transcription initiation factor TFIID subunit 1 OS=Mesocricetus auratus GN=TAF1 PE=2 SV=1 295 367 2.0E-06
sp|Q9H0E9|BRD8_HUMAN Bromodomain-containing protein 8 OS=Homo sapiens GN=BRD8 PE=1 SV=2 304 388 2.0E-06
sp|Q8R3B7|BRD8_MOUSE Bromodomain-containing protein 8 OS=Mus musculus GN=Brd8 PE=1 SV=2 304 388 2.0E-06
sp|P87152|SPT7_SCHPO Transcriptional activator spt7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt7 PE=1 SV=2 306 367 2.0E-06
sp|P21675|TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 295 367 3.0E-06
sp|Q80UV9|TAF1_MOUSE Transcription initiation factor TFIID subunit 1 OS=Mus musculus GN=Taf1 PE=1 SV=2 295 367 3.0E-06
sp|Q8BSQ9|PB1_MOUSE Protein polybromo-1 OS=Mus musculus GN=Pbrm1 PE=1 SV=4 292 397 3.0E-06
sp|Q67W65|TAF1_ORYSJ Transcription initiation factor TFIID subunit 1 OS=Oryza sativa subsp. japonica GN=TAF1 PE=2 SV=1 293 372 4.0E-06
sp|Q8IZX4|TAF1L_HUMAN Transcription initiation factor TFIID subunit 1-like OS=Homo sapiens GN=TAF1L PE=1 SV=1 295 367 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 47 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6304
MGDVKEDNAKRKASEDLTSPSASKRAKHDGTAEAQEEKKSAVKPIPFPEKPAVIEERNGEIEFRVVNNDGDRDSL
IILTGLKCIFQKQLPKMPKDYIARLVYDRTHLSIAIVKKPLEVVGGITYRPFKGRQFAEIVFCAISSDQQVKGYG
AHLMSHLKDYVKASSDVMHFLTYADNYAIGYFKKQGFTKEITLDRRVWMGYIKDYEGGTIMQCSMLPRIRYLEMG
RMLLKQKECVQAKIRAYSKSHNVHPPPREWRAGVREINPLDIPAIRASGWSPDMDELARQPRHGPNYNQLLHLLN
DLQNHQSAWPFLMPVNRDEVADYYDVIKEPMDLSTMENKLEADQYATPEDFIRDARLIFDNCRKYNNENTPYAKS
ATKLEKFMWQQIKAVPEWSHLEQEK*
Coding >Hirsu2|6304
ATGGGCGACGTCAAGGAAGATAACGCCAAGCGCAAGGCATCCGAGGACCTCACGTCGCCGTCGGCCTCGAAGCGG
GCCAAACACGATGGCACGGCCGAGGCACAGGAGGAGAAGAAGTCGGCCGTCAAGCCGATCCCGTTCCCGGAAAAG
CCGGCCGTGATCGAGGAGCGAAACGGCGAGATCGAGTTCAGGGTGGTGAACAACGACGGCGACCGCGACTCGCTC
ATCATCCTGACCGGGCTCAAGTGCATCTTCCAGAAGCAGCTCCCCAAGATGCCCAAGGACTACATCGCGCGGCTC
GTGTACGACCGGACGCACCTGTCGATCGCCATCGTCAAGAAGCCGCTGGAGGTGGTGGGGGGCATCACGTACCGG
CCCTTCAAGGGGCGGCAGTTCGCCGAGATCGTCTTCTGCGCCATCAGCTCGGACCAGCAGGTCAAGGGGTACGGG
GCGCACCTGATGTCGCACCTCAAGGACTACGTCAAGGCCAGCAGCGACGTGATGCACTTCCTGACGTACGCCGAC
AACTACGCCATCGGCTACTTCAAGAAGCAGGGCTTCACCAAGGAGATCACGCTGGACCGGCGCGTCTGGATGGGC
TACATCAAGGACTACGAGGGCGGGACCATCATGCAGTGCTCGATGCTGCCGCGGATCCGGTACCTGGAGATGGGG
CGGATGCTGCTGAAGCAGAAGGAGTGCGTCCAGGCTAAGATCCGGGCCTACTCCAAGTCGCACAACGTGCACCCG
CCGCCGCGCGAGTGGCGCGCCGGCGTGCGCGAGATCAACCCGCTCGACATTCCGGCCATCCGCGCCTCGGGCTGG
TCGCCCGACATGGACGAGCTGGCGCGCCAGCCGCGCCACGGCCCCAACTACAACCAGCTGCTGCACCTCCTCAAC
GACCTGCAGAACCACCAGTCGGCCTGGCCCTTCCTCATGCCCGTTAACCGCGACGAGGTGGCCGACTACTACGAC
GTCATCAAGGAGCCCATGGACCTCAGCACCATGGAGAACAAGCTCGAGGCCGACCAGTACGCCACGCCCGAGGAC
TTCATCCGCGACGCCCGCCTCATCTTCGACAACTGCCGCAAGTACAACAACGAGAACACGCCGTACGCCAAGTCG
GCCACCAAGCTCGAGAAGTTCATGTGGCAGCAGATCAAGGCCGTGCCGGAGTGGTCCCACCTCGAGCAGGAGAAA
TAG
Transcript >Hirsu2|6304
ATGGGCGACGTCAAGGAAGATAACGCCAAGCGCAAGGCATCCGAGGACCTCACGTCGCCGTCGGCCTCGAAGCGG
GCCAAACACGATGGCACGGCCGAGGCACAGGAGGAGAAGAAGTCGGCCGTCAAGCCGATCCCGTTCCCGGAAAAG
CCGGCCGTGATCGAGGAGCGAAACGGCGAGATCGAGTTCAGGGTGGTGAACAACGACGGCGACCGCGACTCGCTC
ATCATCCTGACCGGGCTCAAGTGCATCTTCCAGAAGCAGCTCCCCAAGATGCCCAAGGACTACATCGCGCGGCTC
GTGTACGACCGGACGCACCTGTCGATCGCCATCGTCAAGAAGCCGCTGGAGGTGGTGGGGGGCATCACGTACCGG
CCCTTCAAGGGGCGGCAGTTCGCCGAGATCGTCTTCTGCGCCATCAGCTCGGACCAGCAGGTCAAGGGGTACGGG
GCGCACCTGATGTCGCACCTCAAGGACTACGTCAAGGCCAGCAGCGACGTGATGCACTTCCTGACGTACGCCGAC
AACTACGCCATCGGCTACTTCAAGAAGCAGGGCTTCACCAAGGAGATCACGCTGGACCGGCGCGTCTGGATGGGC
TACATCAAGGACTACGAGGGCGGGACCATCATGCAGTGCTCGATGCTGCCGCGGATCCGGTACCTGGAGATGGGG
CGGATGCTGCTGAAGCAGAAGGAGTGCGTCCAGGCTAAGATCCGGGCCTACTCCAAGTCGCACAACGTGCACCCG
CCGCCGCGCGAGTGGCGCGCCGGCGTGCGCGAGATCAACCCGCTCGACATTCCGGCCATCCGCGCCTCGGGCTGG
TCGCCCGACATGGACGAGCTGGCGCGCCAGCCGCGCCACGGCCCCAACTACAACCAGCTGCTGCACCTCCTCAAC
GACCTGCAGAACCACCAGTCGGCCTGGCCCTTCCTCATGCCCGTTAACCGCGACGAGGTGGCCGACTACTACGAC
GTCATCAAGGAGCCCATGGACCTCAGCACCATGGAGAACAAGCTCGAGGCCGACCAGTACGCCACGCCCGAGGAC
TTCATCCGCGACGCCCGCCTCATCTTCGACAACTGCCGCAAGTACAACAACGAGAACACGCCGTACGCCAAGTCG
GCCACCAAGCTCGAGAAGTTCATGTGGCAGCAGATCAAGGCCGTGCCGGAGTGGTCCCACCTCGAGCAGGAGAAA
TAG
Gene >Hirsu2|6304
ATGGGCGACGTCAAGGAAGATAGTACGGCGCCGCTCCGAACCCAGGCCGGCCGGCCGGAACGCAGCTAACATTGC
GCTGGGCAGACGCCAAGCGCAAGGCATCCGAGGACCTCACGTCGCCGTCGGCCTCGAAGCGGGCCAAACACGATG
GCACGGCCGAGGCACAGGAGGAGAAGAAGTCGGCCGTCAAGCCGATCCCGTTCCCGGAAAAGGTACGCTTGCGAT
TCCGTCGCCGCGGTTGGAGTCGTGTCATCGGTCAGAACAAGACTTGACGAAACAAAACCACACAGCCGGCCGTGA
TCGAGGAGCGAAACGGCGAGATCGAGTTCAGGGTGGTGAACAACGACGGCGACCGCGACTCGCTCATCATCCTGA
CCGGGCTCAAGTGCATCTTCCAGAAGCAGCTCCCCAAGATGCCCAAGGACTACATCGCGCGGCTCGTGTACGACC
GGACGCACCTGTCGATCGCCATCGTCAAGAAGCCGCTGGAGGTGGTGGGGGGCATCACGTACCGGCCCTTCAAGG
GGCGGCAGTTCGCCGAGATCGTCTTCTGCGCCATCAGCTCGGACCAGCAGGTCAAGGGGTACGGGGCGCACCTGA
TGTCGCACCTCAAGGACTACGTCAAGGCCAGCAGCGACGTGATGCACTTCCTGACGTACGCCGACAACTACGCCA
TCGGCTACTTCAAGAAGCAGGGCTTCACCAAGGAGATCACGCTGGACCGGCGCGTCTGGATGGGCTACATCAAGG
ACTACGAGGGCGGGACCATCATGCAGTGCTCGATGCTGCCGCGGATCCGGTACCTGGAGATGGGGCGGATGCTGC
TGAAGCAGAAGGAGTGCGTCCAGGCTAAGATCCGGGCCTACTCCAAGTCGCACAACGTGCACCCGCCGCCGCGCG
AGTGGCGCGCCGGCGTGCGCGAGATCAACCCGCTCGACATTCCGGCCATCCGCGCCTCGGGCTGGTCGCCCGACA
TGGACGAGCTGGCGCGCCAGCCGCGCCACGGCCCCAACTACAACCAGCTGCTGCACCTCCTCAACGACCTGCAGA
ACCACCAGTCGGCCTGGCCCTTCCTCATGCCCGTTAACCGCGACGAGGTGGCCGACTACTACGACGTCATCAAGG
AGCCCATGGACCTCAGCACCATGGAGAACAAGCTCGAGGCCGACCAGTACGCCACGCCCGAGGACTTCATCCGCG
ACGCCCGCCTCATCTTCGACAACTGCCGCAAGTACAACAACGAGAACACGCCGTACGCCAAGTCGGCCACCAAGC
TCGAGAAGTTCATGTGGCAGCAGATCAAGGCCGTGCCGGAGTGGTCCCACCTCGAGCAGGAGAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail