Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6301
Gene name
LocationContig_321:3686..5368
Strand-
Gene length (bp)1682
Transcript length (bp)1470
Coding sequence length (bp)1470
Protein length (aa) 490

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00450 Peptidase_S10 Serine carboxypeptidase 2.8E-54 99 257
PF00450 Peptidase_S10 Serine carboxypeptidase 4.4E-35 269 481

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B2AWD5|CBPYA_PODAN Carboxypeptidase Y homolog A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CPYA PE=3 SV=1 37 480 8.0E-142
sp|D1ZG13|CBPYA_SORMK Carboxypeptidase Y homolog A OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=CPYA PE=3 SV=1 37 480 1.0E-138
sp|Q7RXW8|CBPYA_NEUCR Carboxypeptidase Y homolog A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpyA PE=3 SV=1 37 480 2.0E-138
sp|A4RPY8|CBPYA_MAGO7 Carboxypeptidase Y homolog A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CPYA PE=3 SV=1 37 480 3.0E-137
sp|A7F4H5|CBPYA_SCLS1 Carboxypeptidase Y homolog A OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cpyA PE=3 SV=1 37 481 2.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B2AWD5|CBPYA_PODAN Carboxypeptidase Y homolog A OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=CPYA PE=3 SV=1 37 480 8.0E-142
sp|D1ZG13|CBPYA_SORMK Carboxypeptidase Y homolog A OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=CPYA PE=3 SV=1 37 480 1.0E-138
sp|Q7RXW8|CBPYA_NEUCR Carboxypeptidase Y homolog A OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpyA PE=3 SV=1 37 480 2.0E-138
sp|A4RPY8|CBPYA_MAGO7 Carboxypeptidase Y homolog A OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CPYA PE=3 SV=1 37 480 3.0E-137
sp|A7F4H5|CBPYA_SCLS1 Carboxypeptidase Y homolog A OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=cpyA PE=3 SV=1 37 481 2.0E-136
sp|C7YQJ2|CBPYA_NECH7 Carboxypeptidase Y homolog A OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=CPYA PE=3 SV=1 37 480 2.0E-134
sp|E4USS9|CBPYA_ARTGP Carboxypeptidase Y homolog A OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=CPYA PE=3 SV=1 34 480 3.0E-131
sp|Q2H9G6|CBPYA_CHAGB Carboxypeptidase Y homolog A OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CPYA PE=3 SV=1 48 481 6.0E-131
sp|C5GEU5|CBPYA_AJEDR Carboxypeptidase Y homolog A OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=CPYA PE=3 SV=1 32 480 2.0E-130
sp|C5P212|CBPYA_COCP7 Carboxypeptidase Y homolog A OS=Coccidioides posadasii (strain C735) GN=cpyA PE=3 SV=1 36 480 2.0E-130
sp|A5YCB8|CBPYA_TRITO Carboxypeptidase Y homolog A OS=Trichophyton tonsurans GN=CPYA PE=3 SV=1 34 480 2.0E-130
sp|C5K1Y9|CBPYA_AJEDS Carboxypeptidase Y homolog A OS=Ajellomyces dermatitidis (strain SLH14081) GN=CPYA PE=3 SV=1 32 480 2.0E-130
sp|B8XGR4|CBPYA_TRIEQ Carboxypeptidase Y homolog A OS=Trichophyton equinum GN=CPYA PE=3 SV=1 34 480 6.0E-130
sp|Q0CSD3|CBPYA_ASPTN Carboxypeptidase Y homolog A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=cpyA PE=3 SV=1 37 480 3.0E-129
sp|E5A7I6|CBPYA_LEPMJ Carboxypeptidase Y homolog A OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=CPYA PE=3 SV=1 37 480 5.0E-129
sp|D4DLI1|CBPYA_TRIVH Carboxypeptidase Y homolog A OS=Trichophyton verrucosum (strain HKI 0517) GN=cpyA PE=3 SV=1 34 480 7.0E-129
sp|A6RUD7|CBPYA_BOTFB Carboxypeptidase Y homolog A OS=Botryotinia fuckeliana (strain B05.10) GN=CPYA PE=3 SV=1 37 481 7.0E-129
sp|D4AZ71|CBPYA_ARTBC Carboxypeptidase Y homolog A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=CPYA PE=3 SV=1 34 480 9.0E-129
sp|B8NXS9|CBPYA_ASPFN Carboxypeptidase Y homolog A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=cpyA PE=3 SV=1 37 480 4.0E-128
sp|C5FWJ1|CBPYA_ARTOC Carboxypeptidase Y homolog A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=CPYA PE=3 SV=1 34 480 4.0E-128
sp|C4JNM2|CBPYA_UNCRE Carboxypeptidase Y homolog A OS=Uncinocarpus reesii (strain UAMH 1704) GN=cpyA PE=3 SV=1 36 480 6.0E-128
sp|Q2TYA1|CBPYA_ASPOR Carboxypeptidase Y homolog A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=cpyA PE=3 SV=1 37 480 6.0E-128
sp|A5AB21|CBPYA_ASPNC Carboxypeptidase Y homolog A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cpyA PE=3 SV=1 37 480 3.0E-127
sp|Q5J6J0|CBPYA_TRIRU Carboxypeptidase Y homolog A OS=Trichophyton rubrum GN=cpyA PE=3 SV=1 34 480 9.0E-127
sp|E3QR43|CBPYA_COLGM Carboxypeptidase Y homolog A OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=CPYA PE=3 SV=1 35 480 9.0E-127
sp|A1DP75|CBPYA_NEOFI Carboxypeptidase Y homolog A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=cpyA PE=3 SV=1 37 480 9.0E-127
sp|Q5VJG9|CBPYA_ASPFU Carboxypeptidase Y homolog A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=cpyA PE=3 SV=1 37 480 3.0E-126
sp|B6HPP6|CBPYA_PENRW Carboxypeptidase Y homolog A OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=cpyA PE=3 SV=1 37 480 8.0E-126
sp|A1CUJ5|CBPYA_ASPCL Carboxypeptidase Y homolog A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=cpyA PE=3 SV=1 37 480 2.0E-125
sp|C0NX46|CBPYA_AJECG Carboxypeptidase Y homolog A OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=CPYA PE=3 SV=1 32 480 2.0E-125
sp|A6RGA0|CBPYA_AJECN Carboxypeptidase Y homolog A OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=CPYA PE=3 SV=1 32 480 7.0E-125
sp|Q96VC4|CBPYA_EMENI Carboxypeptidase Y homolog A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cpyA PE=3 SV=1 37 480 3.0E-124
sp|B6QAN5|CBPYA_TALMQ Carboxypeptidase Y homolog A OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=cpyA PE=3 SV=1 36 480 3.0E-123
sp|C1GXD8|CBPYA_PARBA Carboxypeptidase Y homolog A OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=CPYA PE=3 SV=1 37 480 6.0E-123
sp|B8M044|CBPYA_TALSN Carboxypeptidase Y homolog A OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=cpyA PE=3 SV=1 41 480 1.0E-122
sp|B2WKF1|CBPYA_PYRTR Carboxypeptidase Y homolog A OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=cpyA PE=3 SV=1 37 480 2.0E-121
sp|C1GG77|CBPYA_PARBD Carboxypeptidase Y homolog A OS=Paracoccidioides brasiliensis (strain Pb18) GN=CPYA PE=3 SV=1 33 480 1.0E-119
sp|C0SGX7|CBPYA_PARBP Carboxypeptidase Y homolog A OS=Paracoccidioides brasiliensis (strain Pb03) GN=CPYA PE=3 SV=1 33 480 2.0E-119
sp|Q0V1R1|CBPYA_PHANO Carboxypeptidase Y homolog A OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CPYA PE=3 SV=1 33 480 1.0E-118
sp|D4ASE6|SCPF_ARTBC Carboxypeptidase Y homolog ARB_07161 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07161 PE=3 SV=2 37 480 1.0E-115
sp|P30574|CBPY_CANAX Carboxypeptidase Y OS=Candida albicans GN=CPY1 PE=2 SV=2 56 479 2.0E-110
sp|P00729|CBPY_YEAST Carboxypeptidase Y OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRC1 PE=1 SV=1 77 481 4.0E-98
sp|P38109|YBY9_YEAST Putative serine carboxypeptidase YBR139W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR139W PE=1 SV=1 82 479 1.0E-97
sp|P52710|CBPY_PICPG Carboxypeptidase Y OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PRC1 PE=1 SV=1 77 479 6.0E-96
sp|O13849|CBPY_SCHPO Carboxypeptidase Y OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cpy1 PE=1 SV=1 87 479 7.0E-88
sp|P52712|CBPX_ORYSJ Serine carboxypeptidase-like OS=Oryza sativa subsp. japonica GN=CBP31 PE=2 SV=2 102 479 2.0E-60
sp|Q56WF8|SCP48_ARATH Serine carboxypeptidase-like 48 OS=Arabidopsis thaliana GN=SCPL48 PE=2 SV=2 102 481 4.0E-55
sp|P32826|SCP49_ARATH Serine carboxypeptidase-like 49 OS=Arabidopsis thaliana GN=SCPL49 PE=2 SV=2 97 488 2.0E-54
sp|P37891|CBP3_ORYSJ Serine carboxypeptidase 3 OS=Oryza sativa subsp. japonica GN=CBP3 PE=2 SV=1 42 479 3.0E-54
sp|P21529|CBP3_HORVU Serine carboxypeptidase 3 OS=Hordeum vulgare GN=CBP3 PE=1 SV=2 96 479 6.0E-53
sp|Q9FFB0|SCP47_ARATH Serine carboxypeptidase-like 47 OS=Arabidopsis thaliana GN=SCPL47 PE=2 SV=1 102 481 3.0E-51
sp|P11515|CBP3_WHEAT Serine carboxypeptidase 3 OS=Triticum aestivum GN=CBP3 PE=2 SV=1 44 479 4.0E-51
sp|P34946|CPS1_PENJA Carboxypeptidase S1 OS=Penicillium janthinellum PE=1 SV=1 100 471 2.0E-45
sp|D4ANB6|CBPYB_ARTBC Carboxypeptidase Y homolog ARB_05721 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05721 PE=1 SV=1 102 480 1.0E-44
sp|B2W340|KEX1_PYRTR Pheromone-processing carboxypeptidase kex1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=kex1 PE=3 SV=1 100 482 6.0E-41
sp|Q9H3G5|CPVL_HUMAN Probable serine carboxypeptidase CPVL OS=Homo sapiens GN=CPVL PE=1 SV=2 83 481 3.0E-39
sp|Q54DY7|SCPL1_DICDI Serine carboxypeptidase S10 family member 1 OS=Dictyostelium discoideum GN=DDB_G0291912 PE=3 SV=1 102 476 2.0E-38
sp|Q0USX0|KEX1_PHANO Pheromone-processing carboxypeptidase KEX1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=KEX1 PE=3 SV=1 100 482 2.0E-38
sp|B8M719|KEX1_TALSN Pheromone-processing carboxypeptidase kex1 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=kex1 PE=3 SV=1 100 489 4.0E-38
sp|Q9D3S9|CPVL_MOUSE Probable serine carboxypeptidase CPVL OS=Mus musculus GN=Cpvl PE=2 SV=2 45 481 9.0E-38
sp|B6QQZ9|KEX1_TALMQ Pheromone-processing carboxypeptidase kex1 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=kex1 PE=3 SV=1 100 489 2.0E-37
sp|Q5RFE4|CPVL_PONAB Probable serine carboxypeptidase CPVL OS=Pongo abelii GN=CPVL PE=2 SV=1 83 481 3.0E-37
sp|C9WMM5|VCP_APIME Venom serine carboxypeptidase OS=Apis mellifera PE=2 SV=1 97 481 7.0E-37
sp|E5R540|KEX1_LEPMJ Pheromone-processing carboxypeptidase KEX1 OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=KEX1 PE=3 SV=1 100 482 1.0E-36
sp|Q4QR71|CPVL_RAT Probable serine carboxypeptidase CPVL OS=Rattus norvegicus GN=CPVL PE=2 SV=1 88 481 3.0E-36
sp|A2QPW5|KEX1_ASPNC Pheromone-processing carboxypeptidase kex1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=kex1 PE=3 SV=1 100 482 9.0E-36
sp|D5G4B1|KEX1_TUBMM Pheromone-processing carboxypeptidase KEX1 OS=Tuber melanosporum (strain Mel28) GN=KEX1 PE=3 SV=1 100 482 9.0E-36
sp|C9S688|KEX1_VERA1 Pheromone-processing carboxypeptidase KEX1 OS=Verticillium alfalfae (strain VaMs.102 / ATCC MYA-4576 / FGSC 10136) GN=KEX1 PE=3 SV=1 100 482 1.0E-35
sp|Q4WTK9|KEX1_ASPFU Pheromone-processing carboxypeptidase kex1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=kex1 PE=3 SV=1 100 489 1.0E-35
sp|B0XQ16|KEX1_ASPFC Pheromone-processing carboxypeptidase kex1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=kex1 PE=3 SV=1 100 489 1.0E-35
sp|Q1K722|KEX1_NEUCR Pheromone-processing carboxypeptidase kex1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=kex1 PE=3 SV=2 100 482 2.0E-35
sp|A1D3I1|KEX1_NEOFI Pheromone-processing carboxypeptidase kex1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=kex1 PE=3 SV=1 100 489 2.0E-35
sp|P52715|YUA6_CAEEL Uncharacterized serine carboxypeptidase F13S12.6 OS=Caenorhabditis elegans GN=F13D12.6 PE=3 SV=1 97 469 7.0E-35
sp|B2B762|KEX1_PODAN Pheromone-processing carboxypeptidase KEX1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=KEX1 PE=3 SV=1 110 482 4.0E-34
sp|D1ZEM2|KEX1_SORMK Pheromone-processing carboxypeptidase KEX1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=KEX1 PE=3 SV=2 100 482 5.0E-34
sp|Q5BDJ6|KEX1_EMENI Pheromone-processing carboxypeptidase kex1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=kex1 PE=3 SV=2 100 482 7.0E-34
sp|E3L8A5|KEX1_PUCGT Pheromone-processing carboxypeptidase KEX1 OS=Puccinia graminis f. sp. tritici (strain CRL 75-36-700-3 / race SCCL) GN=KEX1 PE=3 SV=2 118 489 9.0E-34
sp|C7YRS6|KEX1_NECH7 Pheromone-processing carboxypeptidase KEX1 OS=Nectria haematococca (strain 77-13-4 / ATCC MYA-4622 / FGSC 9596 / MPVI) GN=KEX1 PE=3 SV=1 99 482 1.0E-33
sp|B6H7A4|KEX1_PENRW Pheromone-processing carboxypeptidase kex1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=kex1 PE=3 SV=1 100 482 1.0E-33
sp|C5FW30|SPCA_ARTOC Carboxypeptidase S1 homolog A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPA PE=3 SV=1 117 478 2.0E-33
sp|A1CQL5|KEX1_ASPCL Pheromone-processing carboxypeptidase kex1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=kex1 PE=3 SV=1 100 489 2.0E-33
sp|P16675|PPGB_MOUSE Lysosomal protective protein OS=Mus musculus GN=Ctsa PE=1 SV=1 99 481 3.0E-33
sp|Q2UPI1|KEX1_ASPOR Pheromone-processing carboxypeptidase kex1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=kex1 PE=3 SV=1 100 482 6.0E-33
sp|Q0CCR9|KEX1_ASPTN Pheromone-processing carboxypeptidase kex1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=kex1 PE=3 SV=1 100 482 8.0E-33
sp|A8NYP0|KEX1_COPC7 Pheromone-processing carboxypeptidase KEX1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=KEX1 PE=3 SV=1 73 482 2.0E-32
sp|Q6CFP3|KEX1_YARLI Pheromone-processing carboxypeptidase KEX1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=KEX1 PE=3 SV=1 97 482 3.0E-32
sp|C5FTV7|KEX1_ARTOC Pheromone-processing carboxypeptidase KEX1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=KEX1 PE=3 SV=1 99 482 4.0E-32
sp|Q09991|YSS2_CAEEL Uncharacterized serine carboxypeptidase K10B2.2 OS=Caenorhabditis elegans GN=K10B2.2 PE=3 SV=1 114 476 4.0E-32
sp|O60123|KEX1_SCHPO Pheromone-processing carboxypeptidase kex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=kex1 PE=3 SV=1 75 481 5.0E-32
sp|A4RE47|KEX1_MAGO7 Pheromone-processing carboxypeptidase KEX1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=KEX1 PE=3 SV=2 100 482 8.0E-32
sp|A7EYY7|KEX1_SCLS1 Pheromone-processing carboxypeptidase kex1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=kex1 PE=3 SV=1 100 482 8.0E-32
sp|Q2GYB7|KEX1_CHAGB Pheromone-processing carboxypeptidase KEX1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=KEX1 PE=3 SV=1 100 482 1.0E-31
sp|E9ESM3|KEX1_METRA Pheromone-processing carboxypeptidase KEX1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) GN=KEX1 PE=3 SV=1 100 482 2.0E-31
sp|B6K7U7|KEX1_SCHJY Pheromone-processing carboxypeptidase kex1 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=kex1 PE=3 SV=1 103 480 2.0E-31
sp|B6V867|SCPA_TRITO Carboxypeptidase S1 homolog A OS=Trichophyton tonsurans GN=SCPA PE=3 SV=1 117 478 2.0E-31
sp|A7UKV5|SPCA_TRIEQ Carboxypeptidase S1 homolog A OS=Trichophyton equinum GN=SCPA PE=3 SV=1 117 478 2.0E-31
sp|C5GC75|KEX1_AJEDR Pheromone-processing carboxypeptidase KEX1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=KEX1 PE=3 SV=1 100 482 3.0E-31
sp|C5JN54|KEX1_AJEDS Pheromone-processing carboxypeptidase KEX1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=KEX1 PE=3 SV=1 100 482 3.0E-31
sp|Q54VW1|SCPL2_DICDI Serine carboxypeptidase S10 family member 2 OS=Dictyostelium discoideum GN=DDB_G0280105 PE=3 SV=1 77 480 4.0E-31
sp|Q5J6J1|SPCA_TRIRU Carboxypeptidase S1 homolog A OS=Trichophyton rubrum GN=SCPA PE=1 SV=1 117 478 4.0E-31
sp|C0SGJ2|KEX1_PARBP Pheromone-processing carboxypeptidase KEX1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=KEX1 PE=3 SV=1 100 489 1.0E-30
sp|C1G2I2|KEX1_PARBD Pheromone-processing carboxypeptidase KEX1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=KEX1 PE=3 SV=1 100 489 1.0E-30
sp|E7R7R2|KEX1_OGAPD Pheromone-processing carboxypeptidase KEX1 OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=KEX1 PE=3 SV=1 103 470 1.0E-30
sp|C1GP85|KEX1_PARBA Pheromone-processing carboxypeptidase KEX1 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=KEX1 PE=3 SV=1 100 489 2.0E-30
sp|E9E1Z2|KEX1_METAQ Pheromone-processing carboxypeptidase KEX1 OS=Metarhizium acridum (strain CQMa 102) GN=KEX1 PE=3 SV=1 100 482 3.0E-30
sp|C5P635|KEX1_COCP7 Pheromone-processing carboxypeptidase KEX1 OS=Coccidioides posadasii (strain C735) GN=KEX1 PE=3 SV=1 100 482 6.0E-30
sp|C4Y8B4|KEX1_CLAL4 Pheromone-processing carboxypeptidase KEX1 OS=Clavispora lusitaniae (strain ATCC 42720) GN=KEX1 PE=3 SV=1 112 482 7.0E-30
sp|E9CS37|KEX1_COCPS Pheromone-processing carboxypeptidase KEX1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) GN=KEX1 PE=3 SV=1 100 482 8.0E-30
sp|Q4P8U8|KEX1_USTMA Pheromone-processing carboxypeptidase KEX1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=KEX1 PE=3 SV=1 115 489 2.0E-29
sp|D0MVS1|KEX1_PHYIT Pheromone-processing carboxypeptidase KEX1 OS=Phytophthora infestans (strain T30-4) GN=KEX1 PE=3 SV=1 100 481 3.0E-29
sp|A6QX86|KEX1_AJECN Pheromone-processing carboxypeptidase KEX1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=KEX1 PE=3 SV=1 100 482 7.0E-29
sp|Q84WF0|SCP37_ARATH Serine carboxypeptidase-like 37 OS=Arabidopsis thaliana GN=SCPL37 PE=2 SV=2 52 488 8.0E-29
sp|A5DAT0|KEX1_PICGU Pheromone-processing carboxypeptidase KEX1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=KEX1 PE=3 SV=2 112 482 8.0E-29
sp|Q9MAR8|SCP44_ARATH Serine carboxypeptidase-like 44 OS=Arabidopsis thaliana GN=SCPL44 PE=2 SV=1 101 469 2.0E-28
sp|C4QZV7|KEX1_PICPG Pheromone-processing carboxypeptidase KEX1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=KEX1 PE=3 SV=1 103 465 4.0E-28
sp|O74702|KEX1_PICPA Pheromone-processing carboxypeptidase KEX1 OS=Komagataella pastoris GN=KEX1 PE=3 SV=1 103 465 4.0E-28
sp|O81009|SCP12_ARATH Serine carboxypeptidase-like 12 OS=Arabidopsis thaliana GN=SCPL12 PE=2 SV=1 115 479 4.0E-28
sp|E3QDT3|KEX1_COLGM Pheromone-processing carboxypeptidase KEX1 OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=KEX1 PE=3 SV=1 100 482 5.0E-28
sp|P42660|VCP_AEDAE Vitellogenic carboxypeptidase OS=Aedes aegypti GN=VCP PE=1 SV=3 81 481 5.0E-28
sp|C4JTD3|KEX1_UNCRE Pheromone-processing carboxypeptidase KEX1 OS=Uncinocarpus reesii (strain UAMH 1704) GN=KEX1 PE=3 SV=1 100 489 1.0E-27
sp|B9WJJ7|KEX1_CANDC Pheromone-processing carboxypeptidase KEX1 OS=Candida dubliniensis (strain CD36 / ATCC MYA-646 / CBS 7987 / NCPF 3949 / NRRL Y-17841) GN=KEX1 PE=3 SV=1 115 476 3.0E-27
sp|Q9M9Q6|SCP50_ARATH Serine carboxypeptidase-like 50 OS=Arabidopsis thaliana GN=SCPL50 PE=2 SV=1 116 479 3.0E-27
sp|Q41005|CBPX_PEA Serine carboxypeptidase-like (Fragment) OS=Pisum sativum PE=2 SV=1 238 479 4.0E-27
sp|Q0WPR4|SCP34_ARATH Serine carboxypeptidase-like 34 OS=Arabidopsis thaliana GN=SCPL34 PE=2 SV=2 83 253 4.0E-27
sp|Q5AFP8|KEX1_CANAL Pheromone-processing carboxypeptidase KEX1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=KEX1 PE=3 SV=1 115 476 1.0E-26
sp|P10619|PPGB_HUMAN Lysosomal protective protein OS=Homo sapiens GN=CTSA PE=1 SV=2 99 267 2.0E-26
sp|P52711|CBP23_HORVU Serine carboxypeptidase II-3 OS=Hordeum vulgare GN=CXP;2-3 PE=2 SV=1 96 480 2.0E-26
sp|C4YTG0|KEX1_CANAW Pheromone-processing carboxypeptidase KEX1 OS=Candida albicans (strain WO-1) GN=KEX1 PE=3 SV=1 115 476 2.0E-26
sp|Q9SV02|SCP39_ARATH Serine carboxypeptidase-like 39 OS=Arabidopsis thaliana GN=SCPL39 PE=2 SV=1 55 255 2.0E-26
sp|Q9SV04|SCP36_ARATH Serine carboxypeptidase-like 36 OS=Arabidopsis thaliana GN=SCPL36 PE=2 SV=1 99 254 4.0E-26
sp|P55748|CBP22_HORVU Serine carboxypeptidase II-2 (Fragment) OS=Hordeum vulgare GN=CXP;2-2 PE=1 SV=1 102 253 5.0E-26
sp|Q869Q8|CPVL_DICDI Probable serine carboxypeptidase CPVL OS=Dictyostelium discoideum GN=cpvl PE=3 SV=1 117 481 1.0E-25
sp|P37890|CBP1_ORYSJ Serine carboxypeptidase 1 OS=Oryza sativa subsp. japonica GN=CBP1 PE=2 SV=1 101 254 3.0E-25
sp|Q4PSY2|SCP32_ARATH Serine carboxypeptidase-like 32 OS=Arabidopsis thaliana GN=SCPL32 PE=2 SV=1 99 469 4.0E-25
sp|Q9CAU0|SCP6_ARATH Serine carboxypeptidase-like 6 OS=Arabidopsis thaliana GN=SCPL6 PE=2 SV=2 115 486 6.0E-25
sp|Q9FH06|SCP41_ARATH Serine carboxypeptidase-like 41 OS=Arabidopsis thaliana GN=SCPL41 PE=2 SV=1 101 480 8.0E-25
sp|Q9C7D6|SCP17_ARATH Serine carboxypeptidase-like 17 OS=Arabidopsis thaliana GN=SCPL17 PE=2 SV=1 104 480 1.0E-24
sp|Q3MI05|PPGB_BOVIN Lysosomal protective protein OS=Bos taurus GN=CTSA PE=2 SV=1 99 267 1.0E-24
sp|P52717|YUW5_CAEEL Uncharacterized serine carboxypeptidase F41C3.5 OS=Caenorhabditis elegans GN=F41C3.5 PE=1 SV=1 101 274 1.0E-24
sp|P07519|CBP1_HORVU Serine carboxypeptidase 1 OS=Hordeum vulgare GN=CBP1 PE=1 SV=4 101 274 2.0E-24
sp|E6R6G5|KEX1_CRYGW Pheromone-processing carboxypeptidase KEX1 OS=Cryptococcus gattii serotype B (strain WM276 / ATCC MYA-4071) GN=KEX1 PE=3 SV=1 116 482 2.0E-24
sp|O64810|SCP10_ARATH Serine carboxypeptidase-like 10 OS=Arabidopsis thaliana GN=SCPL10 PE=2 SV=1 115 480 2.0E-24
sp|Q9LXY6|SCP53_ARATH Putative serine carboxypeptidase-like 53 OS=Arabidopsis thaliana GN=SCPL53 PE=5 SV=1 101 246 2.0E-24
sp|Q8H780|SCP13_ARATH Serine carboxypeptidase-like 13 OS=Arabidopsis thaliana GN=SCPL13 PE=2 SV=2 115 479 3.0E-24
sp|Q93Y09|SCP45_ARATH Serine carboxypeptidase-like 45 OS=Arabidopsis thaliana GN=SCPL45 PE=2 SV=1 101 470 3.0E-24
sp|Q9SQX6|SCP7_ARATH Serine carboxypeptidase-like 7 OS=Arabidopsis thaliana GN=SCPL7 PE=2 SV=1 115 480 4.0E-24
sp|Q8L7B2|SCP20_ARATH Serine carboxypeptidase-like 20 OS=Arabidopsis thaliana GN=SCPL20 PE=2 SV=2 101 254 4.0E-24
sp|Q0WRX3|SCP40_ARATH Serine carboxypeptidase-like 40 OS=Arabidopsis thaliana GN=SCPL40 PE=2 SV=2 102 254 2.0E-23
sp|O23364|SCP30_ARATH Putative serine carboxypeptidase-like 30 OS=Arabidopsis thaliana GN=SCPL30 PE=2 SV=2 99 251 2.0E-23
sp|O64811|SCP9_ARATH Serine carboxypeptidase-like 9 OS=Arabidopsis thaliana GN=SCPL9 PE=2 SV=1 116 479 2.0E-23
sp|Q9LEY1|SCP35_ARATH Serine carboxypeptidase-like 35 OS=Arabidopsis thaliana GN=SCPL35 PE=2 SV=1 101 253 2.0E-23
sp|O04084|SCP31_ARATH Serine carboxypeptidase-like 31 OS=Arabidopsis thaliana GN=SCPL31 PE=2 SV=2 99 253 2.0E-23
sp|Q9LSV8|SCP21_ARATH Serine carboxypeptidase-like 21 OS=Arabidopsis thaliana GN=SCPL21 PE=2 SV=2 101 254 2.0E-23
sp|Q9C7D4|SCP16_ARATH Serine carboxypeptidase-like 16 OS=Arabidopsis thaliana GN=SCPL16 PE=2 SV=1 95 253 3.0E-23
sp|C5DLM9|KEX1_LACTC Pheromone-processing carboxypeptidase KEX1 OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) GN=KEX1 PE=3 SV=1 103 465 4.0E-23
sp|Q9FH05|SCP42_ARATH Serine carboxypeptidase-like 42 OS=Arabidopsis thaliana GN=SCPL42 PE=2 SV=1 101 477 7.0E-23
sp|P42661|NF314_NAEFO Virulence-related protein Nf314 OS=Naegleria fowleri PE=2 SV=1 100 254 7.0E-23
sp|Q9CAU3|SCP2_ARATH Serine carboxypeptidase-like 2 OS=Arabidopsis thaliana GN=SCPL2 PE=2 SV=1 115 481 1.0E-22
sp|Q8RUW5|SCP8_ARATH Serine carboxypeptidase-like 8 OS=Arabidopsis thaliana GN=SCPL8 PE=1 SV=2 116 479 1.0E-22
sp|Q9LSM9|SCP33_ARATH Serine carboxypeptidase-like 33 OS=Arabidopsis thaliana GN=SCPL33 PE=2 SV=2 100 261 1.0E-22
sp|Q8RWJ6|SCP1_ARATH Serine carboxypeptidase-like 1 OS=Arabidopsis thaliana GN=SCPL1 PE=2 SV=1 115 481 2.0E-22
sp|Q2V465|SCP11_ARATH Serine carboxypeptidase-like 11 OS=Arabidopsis thaliana GN=SCPL11 PE=2 SV=2 115 253 3.0E-22
sp|Q8VY01|SCP46_ARATH Serine carboxypeptidase-like 46 OS=Arabidopsis thaliana GN=SCPL46 PE=2 SV=1 101 469 3.0E-22
sp|Q84W27|SCP43_ARATH Serine carboxypeptidase-like 43 OS=Arabidopsis thaliana GN=SCPL43 PE=2 SV=1 101 481 4.0E-22
sp|Q949Q7|SCP29_ARATH Serine carboxypeptidase-like 29 OS=Arabidopsis thaliana GN=SCPL29 PE=2 SV=1 114 254 5.0E-22
sp|Q9C7D2|SCP15_ARATH Serine carboxypeptidase-like 15 OS=Arabidopsis thaliana GN=SCPL15 PE=2 SV=2 115 253 1.0E-21
sp|Q8L9Y0|SCP25_ARATH Serine carboxypeptidase-like 25 OS=Arabidopsis thaliana GN=SCPL25 PE=2 SV=2 99 254 1.0E-21
sp|Q9ZUG3|SCP38_ARATH Serine carboxypeptidase-like 38 OS=Arabidopsis thaliana GN=SCPL38 PE=2 SV=1 99 254 2.0E-21
sp|Q6FTM9|KEX1_CANGA Pheromone-processing carboxypeptidase KEX1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=KEX1 PE=3 SV=1 112 464 2.0E-21
sp|P52716|YPP3_CAEEL Uncharacterized serine carboxypeptidase F32A5.3 OS=Caenorhabditis elegans GN=F32A5.3 PE=1 SV=1 101 261 2.0E-21
sp|D4AQA7|PEPS_ARTBC Probable serine carboxypeptidase ARB_06414 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06414 PE=1 SV=1 79 471 2.0E-21
sp|Q9SFB5|SCP27_ARATH Serine carboxypeptidase-like 27 OS=Arabidopsis thaliana GN=SCPL27 PE=2 SV=1 101 253 3.0E-21
sp|Q8S8K6|SCP28_ARATH Serine carboxypeptidase-like 28 OS=Arabidopsis thaliana GN=SCPL28 PE=2 SV=2 102 254 4.0E-21
sp|Q920A5|RISC_MOUSE Retinoid-inducible serine carboxypeptidase OS=Mus musculus GN=Scpep1 PE=1 SV=2 115 477 4.0E-21
sp|Q9FFB2|SCP54_ARATH Putative serine carboxypeptidase-like 54 OS=Arabidopsis thaliana GN=SCPL54 PE=5 SV=1 95 253 5.0E-21
sp|Q9C7D3|SCP14_ARATH Serine carboxypeptidase-like 14 OS=Arabidopsis thaliana GN=SCPL14 PE=2 SV=1 104 253 5.0E-21
sp|Q9CAU2|SCP5_ARATH Serine carboxypeptidase-like 5 OS=Arabidopsis thaliana GN=SCPL5 PE=2 SV=2 115 481 5.0E-21
sp|Q9M099|SCP24_ARATH Serine carboxypeptidase 24 OS=Arabidopsis thaliana GN=SCPL24 PE=1 SV=1 102 267 8.0E-21
sp|Q9C7Z9|SCP18_ARATH Serine carboxypeptidase-like 18 OS=Arabidopsis thaliana GN=SCPL18 PE=2 SV=2 113 253 4.0E-20
sp|P08819|CBP2_WHEAT Serine carboxypeptidase 2 OS=Triticum aestivum GN=CBP2 PE=1 SV=2 102 251 2.0E-19
sp|Q9ZQQ0|SCP26_ARATH Serine carboxypeptidase-like 26 OS=Arabidopsis thaliana GN=SCPL26 PE=2 SV=1 96 253 2.0E-19
sp|Q9HB40|RISC_HUMAN Retinoid-inducible serine carboxypeptidase OS=Homo sapiens GN=SCPEP1 PE=1 SV=1 115 476 3.0E-19
sp|Q9CAU1|SCP3_ARATH Serine carboxypeptidase-like 3 OS=Arabidopsis thaliana GN=SCPL3 PE=2 SV=1 115 253 5.0E-19
sp|O82229|SCP23_ARATH Putative serine carboxypeptidase-like 23 OS=Arabidopsis thaliana GN=SCPL23 PE=2 SV=2 102 253 5.0E-19
sp|Q1PF08|SCP22_ARATH Serine carboxypeptidase-like 22 OS=Arabidopsis thaliana GN=SCPL22 PE=2 SV=1 102 253 7.0E-19
sp|P52719|PEPS_ASPPH Carboxypeptidase cpdS OS=Aspergillus phoenicis GN=cpdS PE=1 SV=1 87 254 1.0E-18
sp|P08818|CBP2_HORVU Serine carboxypeptidase 2 OS=Hordeum vulgare GN=CBP2 PE=1 SV=2 102 251 2.0E-18
sp|B5RUL7|KEX1_DEBHA Pheromone-processing carboxypeptidase KEX1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KEX1 PE=3 SV=1 112 254 3.0E-18
sp|Q9CAU4|SCP4_ARATH Serine carboxypeptidase-like 4 OS=Arabidopsis thaliana GN=SCPL4 PE=2 SV=1 115 253 3.0E-18
sp|D4AZG9|SCPE_ARTBC Carboxypeptidase Y homolog ARB_06361 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01587 PE=3 SV=1 98 262 7.0E-18
sp|C5DT72|KEX1_ZYGRC Pheromone-processing carboxypeptidase KEX1 OS=Zygosaccharomyces rouxii (strain ATCC 2623 / CBS 732 / NBRC 1130 / NCYC 568 / NRRL Y-229) GN=KEX1 PE=3 SV=1 109 468 9.0E-18
sp|Q752M5|KEX1_ASHGO Pheromone-processing carboxypeptidase KEX1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=KEX1 PE=3 SV=1 84 469 2.0E-17
sp|D4B0Q6|SCPD_ARTBC Carboxypeptidase Y homolog ARB_02032 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02032 PE=3 SV=2 51 476 5.0E-17
sp|P52714|YXD2_CAEEL Uncharacterized serine carboxypeptidase C08H9.1 OS=Caenorhabditis elegans GN=C08H9.1 PE=1 SV=1 97 256 1.0E-16
sp|D4B5L8|KEX1_ARTBC Pheromone-processing carboxypeptidase KEX1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=KEX1 PE=3 SV=1 185 489 4.0E-16
sp|C5MFP8|KEX1_CANTT Pheromone-processing carboxypeptidase KEX1 OS=Candida tropicalis (strain ATCC MYA-3404 / T1) GN=KEX1 PE=3 SV=1 112 254 5.0E-16
sp|D4AIF1|SCPA_ARTBC Carboxypeptidase S1 homolog A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPA PE=3 SV=1 117 250 6.0E-16
sp|D4DD24|SCPA_TRIVH Carboxypeptidase S1 homolog A OS=Trichophyton verrucosum (strain HKI 0517) GN=SCPA PE=3 SV=1 117 250 6.0E-16
sp|P52708|HNLS_SORBI P-(S)-hydroxymandelonitrile lyase OS=Sorghum bicolor PE=1 SV=2 103 267 7.0E-16
sp|Q920A6|RISC_RAT Retinoid-inducible serine carboxypeptidase OS=Rattus norvegicus GN=Scpep1 PE=2 SV=1 115 476 1.0E-14
sp|Q8VZU3|SCP19_ARATH Serine carboxypeptidase-like 19 OS=Arabidopsis thaliana GN=SCPL19 PE=1 SV=1 116 247 1.0E-14
sp|C5FGX1|SCPB_ARTOC Carboxypeptidase S1 homolog B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPB PE=3 SV=1 117 249 2.0E-14
sp|A7TLB3|KEX1_VANPO Pheromone-processing carboxypeptidase KEX1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=KEX1 PE=3 SV=1 117 253 2.0E-14
sp|Q5J6J2|SCPB_TRIRU Carboxypeptidase S1 homolog B OS=Trichophyton rubrum GN=SCPB PE=1 SV=1 98 249 2.0E-14
sp|P32825|SXA2_SCHPO Carboxypeptidase sxa2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sxa2 PE=2 SV=1 88 261 6.0E-14
sp|D4DD24|SCPA_TRIVH Carboxypeptidase S1 homolog A OS=Trichophyton verrucosum (strain HKI 0517) GN=SCPA PE=3 SV=1 343 478 3.0E-13
sp|D4AIF1|SCPA_ARTBC Carboxypeptidase S1 homolog A OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPA PE=3 SV=1 343 478 4.0E-13
sp|C8Z852|KEX1_YEAS8 Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) GN=KEX1 PE=3 SV=1 101 254 6.0E-13
sp|A5E751|KEX1_LODEL Pheromone-processing carboxypeptidase KEX1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=KEX1 PE=3 SV=1 112 254 6.0E-13
sp|P09620|KEX1_YEAST Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KEX1 PE=1 SV=1 101 254 7.0E-13
sp|D4AQ54|SCPC_ARTBC Carboxypeptidase Y homolog ARB_06361 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_06361 PE=1 SV=1 87 200 7.0E-13
sp|E7NHF8|KEX1_YEASO Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain FostersO) GN=KEX1 PE=3 SV=1 101 254 7.0E-13
sp|C7GWZ2|KEX1_YEAS2 Pheromone-processing carboxypeptidase KEX1 OS=Saccharomyces cerevisiae (strain JAY291) GN=KEX1 PE=3 SV=1 101 254 8.0E-13
sp|Q6CKK4|KEX1_KLULA Pheromone-processing carboxypeptidase KEX1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=KEX1 PE=3 SV=1 113 254 9.0E-12
sp|D4AP52|SCPB_ARTBC Carboxypeptidase S1 homolog B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPB PE=3 SV=1 117 249 6.0E-11
sp|Q67Y83|SCP51_ARATH Serine carboxypeptidase-like 51 OS=Arabidopsis thaliana GN=SCPL51 PE=2 SV=2 113 268 8.0E-10
sp|Q67Y83|SCP51_ARATH Serine carboxypeptidase-like 51 OS=Arabidopsis thaliana GN=SCPL51 PE=2 SV=2 375 476 3.0E-09
sp|B5RUL7|KEX1_DEBHA Pheromone-processing carboxypeptidase KEX1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=KEX1 PE=3 SV=1 344 480 4.0E-09
sp|C5FGX1|SCPB_ARTOC Carboxypeptidase S1 homolog B OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SCPB PE=3 SV=1 365 478 5.0E-09
sp|Q5J6J2|SCPB_TRIRU Carboxypeptidase S1 homolog B OS=Trichophyton rubrum GN=SCPB PE=1 SV=1 365 478 1.0E-08
sp|A5E751|KEX1_LODEL Pheromone-processing carboxypeptidase KEX1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=KEX1 PE=3 SV=1 344 470 1.0E-08
sp|D4AP52|SCPB_ARTBC Carboxypeptidase S1 homolog B OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=SCPB PE=3 SV=1 365 478 1.0E-08
sp|P52718|PEPF_ASPNG Serine-type carboxypeptidase F OS=Aspergillus niger GN=pepF PE=1 SV=3 114 260 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0006508 proteolysis Yes
GO:0004185 serine-type carboxypeptidase activity Yes
GO:0017171 serine hydrolase activity No
GO:0016787 hydrolase activity No
GO:0008150 biological_process No
GO:0019538 protein metabolic process No
GO:0003824 catalytic activity No
GO:0071704 organic substance metabolic process No
GO:0008238 exopeptidase activity No
GO:0008152 metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0008236 serine-type peptidase activity No
GO:0044238 primary metabolic process No
GO:0008233 peptidase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:0140096 catalytic activity, acting on a protein No
GO:0070008 serine-type exopeptidase activity No
GO:0003674 molecular_function No
GO:0043170 macromolecule metabolic process No
GO:0004180 carboxypeptidase activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0849 0.0499 0.935 0.0611 0.1056 0.0157 0.2022 0.3269 0.249 0.0052

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999536

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup40
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|43
Ophiocordyceps australis 1348a (Ghana) OphauG2|7621
Ophiocordyceps australis 1348a (Ghana) OphauG2|3835
Ophiocordyceps australis map64 (Brazil) OphauB2|1284
Ophiocordyceps australis map64 (Brazil) OphauB2|1583
Ophiocordyceps australis map64 (Brazil) OphauB2|5677
Ophiocordyceps camponoti-floridani Ophcf2|05748
Ophiocordyceps camponoti-floridani Ophcf2|05370
Ophiocordyceps camponoti-floridani Ophcf2|05020
Ophiocordyceps camponoti-floridani Ophcf2|00504
Ophiocordyceps camponoti-rufipedis Ophun1|4321
Ophiocordyceps camponoti-rufipedis Ophun1|3466
Ophiocordyceps kimflemingae Ophio5|2080
Ophiocordyceps kimflemingae Ophio5|2360
Ophiocordyceps kimflemingae Ophio5|3956
Ophiocordyceps kimflemingae Ophio5|4186
Ophiocordyceps subramaniannii Hirsu2|650
Ophiocordyceps subramaniannii Hirsu2|6301 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3759
Ophiocordyceps subramaniannii Hirsu2|289
Ophiocordyceps subramaniannii Hirsu2|2051
Ophiocordyceps subramaniannii Hirsu2|1557

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6301
MRTKALALALAGGAIFLSPALARGEATSPGQSSVPAPVEATRTPDSSWDAIIRGSKVLQRRKRVPGQAADGDVDG
MIKNCDMRVREVRESELKKFGIDTVRQHAGYLDDDVNKKHLFFWFFESRNDPANDPVMLWLNGGPGCSSFTGLFD
ELGPASIESKKVEGTSETWRVFQKKSRVHAANNSASVIFIDQPVNVGYSYSENPVNSTRAASADIYSLLTLFFHH
FPHYAKQDFYIAGESYAGYHVPVFARDILASTMSEPMACGQGGYEAVLNETQCEDMKRQLPACTNQIKACYDQGE
GAQICSDAIDTSDSMAFLHYNKDTYDIRYNNGYTDSLTTTKDGFLALEKVRKLLNVEVETFAVCSDQIWLDFYKQ
SDWTRPSHLDVREVLKDIPVLIYAGDADYICNWLGNQAWTEALDWPGRDVFNAAETRPVRSASSQSDWGTVKAAH
NLAFVRVFQAGHLVPTSQPESFIDMINRWFHVVAIHTAG*
Coding >Hirsu2|6301
ATGCGTACCAAAGCACTCGCTCTCGCCCTCGCCGGCGGCGCTATCTTCCTCTCTCCGGCCCTGGCCCGTGGCGAG
GCCACTTCGCCGGGGCAGTCCTCGGTTCCTGCCCCCGTCGAGGCGACCCGGACACCCGACAGCTCCTGGGACGCT
ATCATTCGCGGGAGCAAGGTACTGCAGCGCCGTAAGCGGGTCCCGGGCCAGGCGGCCGATGGCGATGTCGACGGC
ATGATCAAGAACTGCGACATGCGCGTTAGAGAGGTCAGAGAGTCTGAGCTGAAGAAGTTTGGGATCGATACGGTG
CGGCAACATGCCGGCTATCTGGACGACGATGTCAACAAAAAGCACCTGTTTTTCTGGTTCTTCGAGTCCCGAAAC
GACCCGGCCAACGACCCCGTCATGCTCTGGCTCAACGGCGGACCAGGTTGCTCCTCCTTCACCGGCCTTTTCGAC
GAGCTGGGCCCGGCCTCCATCGAATCCAAGAAAGTGGAAGGGACCTCCGAGACATGGAGGGTGTTCCAGAAAAAA
AGCCGAGTCCACGCGGCCAACAACAGCGCCTCCGTTATCTTTATCGACCAGCCCGTCAACGTAGGCTACTCGTAT
AGTGAGAATCCCGTCAATTCGACCAGGGCCGCGAGCGCCGATATCTACAGTCTCCTCACCCTCTTCTTCCATCAT
TTTCCCCATTACGCCAAGCAAGACTTCTATATCGCTGGCGAGTCGTATGCCGGCTATCATGTCCCCGTCTTCGCC
CGCGATATCCTCGCTAGTACTATGAGCGAGCCTATGGCGTGCGGCCAGGGCGGCTACGAGGCGGTCCTAAACGAG
ACCCAATGCGAGGATATGAAACGTCAGTTACCCGCGTGCACGAACCAGATCAAGGCTTGCTATGATCAAGGCGAG
GGGGCTCAGATATGTTCCGACGCAATCGACACCAGTGACAGCATGGCCTTTCTGCATTACAACAAGGACACGTAC
GACATCCGCTATAACAATGGATATACTGATAGCCTCACGACCACCAAGGACGGGTTTCTCGCTCTTGAGAAGGTT
CGAAAGCTCCTCAATGTCGAGGTTGAAACCTTCGCAGTCTGCTCGGACCAGATTTGGTTAGACTTCTATAAGCAA
AGCGACTGGACGAGACCATCGCACCTCGACGTCCGCGAGGTTCTAAAGGATATCCCCGTCCTTATCTACGCCGGG
GACGCCGACTATATTTGCAACTGGCTCGGCAATCAAGCCTGGACCGAGGCCCTTGACTGGCCCGGCCGCGATGTC
TTTAACGCCGCCGAGACGAGGCCCGTCCGGAGTGCTTCCAGCCAGTCCGACTGGGGTACCGTCAAGGCCGCTCAC
AACTTGGCATTTGTCCGTGTCTTCCAGGCCGGCCATCTAGTCCCCACAAGCCAGCCTGAGTCTTTCATCGATATG
ATTAACCGATGGTTTCATGTTGTTGCGATACATACAGCTGGCTAG
Transcript >Hirsu2|6301
ATGCGTACCAAAGCACTCGCTCTCGCCCTCGCCGGCGGCGCTATCTTCCTCTCTCCGGCCCTGGCCCGTGGCGAG
GCCACTTCGCCGGGGCAGTCCTCGGTTCCTGCCCCCGTCGAGGCGACCCGGACACCCGACAGCTCCTGGGACGCT
ATCATTCGCGGGAGCAAGGTACTGCAGCGCCGTAAGCGGGTCCCGGGCCAGGCGGCCGATGGCGATGTCGACGGC
ATGATCAAGAACTGCGACATGCGCGTTAGAGAGGTCAGAGAGTCTGAGCTGAAGAAGTTTGGGATCGATACGGTG
CGGCAACATGCCGGCTATCTGGACGACGATGTCAACAAAAAGCACCTGTTTTTCTGGTTCTTCGAGTCCCGAAAC
GACCCGGCCAACGACCCCGTCATGCTCTGGCTCAACGGCGGACCAGGTTGCTCCTCCTTCACCGGCCTTTTCGAC
GAGCTGGGCCCGGCCTCCATCGAATCCAAGAAAGTGGAAGGGACCTCCGAGACATGGAGGGTGTTCCAGAAAAAA
AGCCGAGTCCACGCGGCCAACAACAGCGCCTCCGTTATCTTTATCGACCAGCCCGTCAACGTAGGCTACTCGTAT
AGTGAGAATCCCGTCAATTCGACCAGGGCCGCGAGCGCCGATATCTACAGTCTCCTCACCCTCTTCTTCCATCAT
TTTCCCCATTACGCCAAGCAAGACTTCTATATCGCTGGCGAGTCGTATGCCGGCTATCATGTCCCCGTCTTCGCC
CGCGATATCCTCGCTAGTACTATGAGCGAGCCTATGGCGTGCGGCCAGGGCGGCTACGAGGCGGTCCTAAACGAG
ACCCAATGCGAGGATATGAAACGTCAGTTACCCGCGTGCACGAACCAGATCAAGGCTTGCTATGATCAAGGCGAG
GGGGCTCAGATATGTTCCGACGCAATCGACACCAGTGACAGCATGGCCTTTCTGCATTACAACAAGGACACGTAC
GACATCCGCTATAACAATGGATATACTGATAGCCTCACGACCACCAAGGACGGGTTTCTCGCTCTTGAGAAGGTT
CGAAAGCTCCTCAATGTCGAGGTTGAAACCTTCGCAGTCTGCTCGGACCAGATTTGGTTAGACTTCTATAAGCAA
AGCGACTGGACGAGACCATCGCACCTCGACGTCCGCGAGGTTCTAAAGGATATCCCCGTCCTTATCTACGCCGGG
GACGCCGACTATATTTGCAACTGGCTCGGCAATCAAGCCTGGACCGAGGCCCTTGACTGGCCCGGCCGCGATGTC
TTTAACGCCGCCGAGACGAGGCCCGTCCGGAGTGCTTCCAGCCAGTCCGACTGGGGTACCGTCAAGGCCGCTCAC
AACTTGGCATTTGTCCGTGTCTTCCAGGCCGGCCATCTAGTCCCCACAAGCCAGCCTGAGTCTTTCATCGATATG
ATTAACCGATGGTTTCATGTTGTTGCGATACATACAGCTGGCTAG
Gene >Hirsu2|6301
ATGCGTACCAAAGCACTCGCTCTCGCCCTCGCCGGCGGCGCTATCTTCCTCTCTCCGGCCCTGGCCCGTGGCGAG
GCCACTTCGCCGGGGCAGTCCTCGGTTCCTGCCCCCGTCGAGGCGACCCGGACACCCGACAGCTCCTGGGACGCT
ATCATTCGCGGGAGCAAGGTACTGCAGCGCCGTAAGCGGGTCCCGGGCCAGGCGGCCGATGGCGATGTCGACGGC
ATGATCAAGAACTGCGACATGCGCGTTAGAGAGGTCAGAGAGTCTGAGCTGAAGAAGTTTGGGATCGATACGGTG
CGGCAACATGCCGGCTATCTGGACGACGATGTCAACAAAAAGCACCTGTTTTTCTGTAAGCTACTGCTTTACCCC
CGCCCCTCTCCCTCTCTCCCTATCTCCACGTGTGTCTATATGCCGTCTGCTTCTCGCCTATATATAAACCTGCCA
CGCCTTACGAACGTTCATCACGCTGAAGTCCTCCCCCTCTTCGATCCAGGGTTCTTCGAGTCCCGAAACGACCCG
GCCAACGACCCCGTCATGCTCTGGCTCAACGGCGGACCAGGTTGCTCCTCCTTCACCGGCCTTTTCGACGAGCTG
GGCCCGGCCTCCATCGAATCCAAGAAAGTGGAAGGGACCTCCGAGACATGGAGGGTGTTCCAGAAAAAAAGCCGA
GTCCACGCGGCCAACAACAGCGCCTCCGTTATCTTTATCGACCAGCCCGTCAACGTAGGCTACTCGTATAGTGAG
AATCCCGTCAATTCGACCAGGGCCGCGAGCGCCGATATCTACAGTCTCCTCACCCTCTTCTTCCATCATTTTCCC
CATTACGCCAAGCAAGACTTCTATATCGCTGGCGAGTCGTATGCCGGCTATCATGTCCCCGTCTTCGCCCGCGAT
ATCCTCGCTAGGTCACAATATTAACCTAAAGAGTATCCTGATCGGCAACGGGATGACGAACCCGCTTACACAGTC
CCAGTACTATGAGCGAGCCTATGGCGTGCGGCCAGGGCGGCTACGAGGCGGTCCTAAACGAGACCCAATGCGAGG
ATATGAAACGTCAGTTACCCGCGTGCACGAACCAGATCAAGGCTTGCTATGATCAAGGCGAGGGGGCTCAGATAT
GTTCCGACGCAATCGACACCAGTGACAGCATGGCCTTTCTGCATTACAACAAGGACACGTACGACATCCGCTATA
ACAATGGATATACTGATAGCCTCACGACCACCAAGGACGGGTTTCTCGCTCTTGAGAAGGTTCGAAAGCTCCTCA
ATGTCGAGGTTGAAACCTTCGCAGTCTGCTCGGACCAGATTTGGTTAGACTTCTATAAGCAAAGCGACTGGACGA
GACCATCGCACCTCGACGTCCGCGAGGTTCTAAAGGATATCCCCGTCCTTATCTACGCCGGGGACGCCGACTATA
TTTGCAACTGGCTCGGCAATCAAGCCTGGACCGAGGCCCTTGACTGGCCCGGCCGCGATGTCTTTAACGCCGCCG
AGACGAGGCCCGTCCGGAGTGCTTCCAGCCAGTCCGACTGGGGTACCGTCAAGGCCGCTCACAACTTGGCATTTG
TCCGTGTCTTCCAGGCCGGCCATCTAGTCCCCACAAGCCAGCCTGAGTCTTTCATCGATATGATTAACCGATGGT
TTCATGTTGTTGCGATACATACAGCTGGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail