Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|630
Gene name
LocationContig_1126:4916..6661
Strand+
Gene length (bp)1745
Transcript length (bp)1521
Coding sequence length (bp)1521
Protein length (aa) 507

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03917 GSH_synth_ATP Eukaryotic glutathione synthase, ATP binding domain 5.8E-138 12 505
PF03199 GSH_synthase Eukaryotic glutathione synthase 5.4E-33 220 326

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P35669|GSHB_SCHPO Glutathione synthetase large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsa1 PE=1 SV=2 1 505 5.0E-112
sp|Q08220|GSHB_YEAST Glutathione synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSH2 PE=1 SV=1 1 505 8.0E-112
sp|P35668|GSHB_XENLA Glutathione synthetase OS=Xenopus laevis GN=gss PE=2 SV=1 22 506 5.0E-91
sp|Q8HXX5|GSHB_MACFA Glutathione synthetase OS=Macaca fascicularis GN=GSS PE=2 SV=1 9 502 1.0E-87
sp|Q5EAC2|GSHB_BOVIN Glutathione synthetase OS=Bos taurus GN=GSS PE=2 SV=1 10 502 3.0E-86
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P35669|GSHB_SCHPO Glutathione synthetase large chain OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gsa1 PE=1 SV=2 1 505 5.0E-112
sp|Q08220|GSHB_YEAST Glutathione synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GSH2 PE=1 SV=1 1 505 8.0E-112
sp|P35668|GSHB_XENLA Glutathione synthetase OS=Xenopus laevis GN=gss PE=2 SV=1 22 506 5.0E-91
sp|Q8HXX5|GSHB_MACFA Glutathione synthetase OS=Macaca fascicularis GN=GSS PE=2 SV=1 9 502 1.0E-87
sp|Q5EAC2|GSHB_BOVIN Glutathione synthetase OS=Bos taurus GN=GSS PE=2 SV=1 10 502 3.0E-86
sp|P48637|GSHB_HUMAN Glutathione synthetase OS=Homo sapiens GN=GSS PE=1 SV=1 18 502 8.0E-86
sp|Q54E83|GSHB_DICDI Glutathione synthetase OS=Dictyostelium discoideum GN=gshB PE=3 SV=1 22 505 7.0E-85
sp|P46413|GSHB_RAT Glutathione synthetase OS=Rattus norvegicus GN=Gss PE=1 SV=1 10 502 2.0E-83
sp|P51855|GSHB_MOUSE Glutathione synthetase OS=Mus musculus GN=Gss PE=1 SV=1 10 502 5.0E-82
sp|O22494|GSHB_SOLLC Glutathione synthetase, chloroplastic OS=Solanum lycopersicum GN=GSH2 PE=2 SV=1 46 506 1.0E-75
sp|O23732|GSHB_BRAJU Glutathione synthetase, chloroplastic OS=Brassica juncea GN=GSH2 PE=2 SV=1 5 505 3.0E-73
sp|P46416|GSHB_ARATH Glutathione synthetase, chloroplastic OS=Arabidopsis thaliana GN=GSH2 PE=2 SV=3 23 506 2.0E-71
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0004363 glutathione synthase activity Yes
GO:0006750 glutathione biosynthetic process Yes
GO:0008152 metabolic process No
GO:0006518 peptide metabolic process No
GO:0044237 cellular metabolic process No
GO:0043604 amide biosynthetic process No
GO:0051188 cofactor biosynthetic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0071704 organic substance metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0006790 sulfur compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006749 glutathione metabolic process No
GO:0016874 ligase activity No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0006575 cellular modified amino acid metabolic process No
GO:0008144 drug binding No
GO:0043603 cellular amide metabolic process No
GO:0042398 cellular modified amino acid biosynthetic process No
GO:0003674 molecular_function No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0032555 purine ribonucleotide binding No
GO:0009987 cellular process No
GO:1901564 organonitrogen compound metabolic process No
GO:0051186 cofactor metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0044249 cellular biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044272 sulfur compound biosynthetic process No
GO:0009058 biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016881 acid-amino acid ligase activity No
GO:0032553 ribonucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0019184 nonribosomal peptide biosynthetic process No
GO:0043043 peptide biosynthetic process No
GO:0017076 purine nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|630
MDAYPPPLTEAERDGLVQAVKDWSMANGLAVRTPPAVLPAEADPAGITAIGAPVTLFPSPFPRVCFDQAVAVQRT
YNELYAAVSRDEDFLADVVKQVGDGDDFIQNLWQIHLRVKQEGYTQPLSLGLFRSDYMVHQDGSTLQAKQVEFNT
IAASFGGLSEHTSRLHKFLAATEYPLLERPIAAGTALLDLPENRPVRGLAAGLRAAHAAYAPSEELGLPTCVLFV
VQAGERNVFDQRHLEYELATTTRLFRLALADVAAHTSVADTARRQLLYRHGPSGRHFEVAVVYLRAGYGPADYPD
RRAWEARYRLERSAAIKCPSVLTQLAGAKKVQQLLAAAGALGRFLRDADDDGSSPAVAALRRTFTNIYPMDAASP
AGREARARALDPDRCAAYVLKPQREGGGNNTYRAAIPAFLRSVPEEHWPSFILMELITPPPVSNLILRNGAVEQG
GVICELGVYGTCLWHQRTGELLHNDEAGHLLRTKGDQSEEGGVAAGYGCMDSCALV*
Coding >Hirsu2|630
ATGGACGCCTATCCTCCTCCCCTGACCGAGGCCGAGCGGGACGGCCTCGTCCAGGCCGTCAAGGACTGGTCTATG
GCCAACGGGCTGGCGGTCCGGACGCCGCCGGCCGTCCTTCCCGCCGAGGCCGACCCGGCCGGCATCACCGCCATC
GGCGCGCCCGTCACCCTCTTCCCGAGCCCGTTCCCGCGCGTCTGCTTCGACCAGGCCGTGGCGGTGCAGAGGACG
TACAACGAGCTCTACGCCGCCGTCAGCCGCGACGAGGACTTTCTGGCCGACGTGGTCAAGCAAGTCGGGGATGGA
GACGACTTCATCCAGAACCTGTGGCAGATTCACCTCAGGGTCAAGCAGGAGGGATACACGCAGCCGCTCTCCCTC
GGCCTGTTCCGGTCAGACTACATGGTCCACCAGGACGGCTCGACGCTGCAGGCCAAACAGGTCGAGTTCAACACC
ATCGCCGCCTCCTTCGGTGGCCTCTCGGAGCACACGTCGCGCCTTCACAAATTCCTCGCCGCGACTGAGTACCCG
CTCCTGGAGCGGCCGATCGCGGCCGGCACCGCCCTCCTCGACCTGCCGGAGAACCGGCCGGTGCGGGGCCTCGCG
GCCGGTCTGCGGGCCGCCCACGCCGCGTACGCGCCCTCGGAGGAGCTGGGGCTCCCGACCTGCGTCCTGTTCGTG
GTCCAGGCCGGCGAGCGCAACGTCTTCGACCAGCGCCACCTGGAGTACGAGCTCGCGACGACGACGCGCCTGTTC
CGGCTCGCCCTCGCCGACGTCGCCGCCCACACCTCCGTCGCCGACACCGCCCGGCGCCAGCTCCTCTACCGCCAC
GGCCCGTCCGGAAGGCATTTCGAGGTTGCCGTCGTCTACCTGCGCGCCGGCTACGGCCCGGCCGACTACCCCGAC
CGCCGCGCCTGGGAGGCCCGGTACCGGCTTGAGCGCTCCGCCGCCATCAAGTGCCCGTCGGTGCTGACGCAGCTG
GCCGGCGCCAAGAAGGTCCAGCAGCTGCTCGCCGCAGCCGGGGCGCTCGGCCGGTTCCTCCGCGACGCCGACGAC
GACGGCTCGTCGCCAGCCGTCGCCGCGCTGCGCCGCACCTTCACCAACATCTACCCCATGGACGCCGCCTCCCCG
GCCGGGCGCGAGGCCCGCGCCAGGGCCCTGGACCCGGACCGCTGCGCCGCCTACGTGCTCAAGCCGCAGCGCGAG
GGCGGCGGCAACAACACGTACCGGGCCGCCATCCCGGCCTTCCTCCGGTCCGTGCCCGAGGAGCACTGGCCGTCC
TTCATCCTCATGGAGCTCATTACGCCGCCGCCCGTGTCGAACCTCATCCTGCGCAACGGCGCGGTCGAGCAGGGC
GGCGTCATCTGCGAGCTCGGCGTCTACGGCACCTGTCTCTGGCACCAGCGCACCGGCGAGCTGCTGCACAACGAC
GAGGCCGGCCACCTGCTGCGCACCAAGGGCGACCAGAGCGAGGAGGGCGGCGTGGCGGCGGGATACGGATGCATG
GACAGCTGCGCCCTGGTTTGA
Transcript >Hirsu2|630
ATGGACGCCTATCCTCCTCCCCTGACCGAGGCCGAGCGGGACGGCCTCGTCCAGGCCGTCAAGGACTGGTCTATG
GCCAACGGGCTGGCGGTCCGGACGCCGCCGGCCGTCCTTCCCGCCGAGGCCGACCCGGCCGGCATCACCGCCATC
GGCGCGCCCGTCACCCTCTTCCCGAGCCCGTTCCCGCGCGTCTGCTTCGACCAGGCCGTGGCGGTGCAGAGGACG
TACAACGAGCTCTACGCCGCCGTCAGCCGCGACGAGGACTTTCTGGCCGACGTGGTCAAGCAAGTCGGGGATGGA
GACGACTTCATCCAGAACCTGTGGCAGATTCACCTCAGGGTCAAGCAGGAGGGATACACGCAGCCGCTCTCCCTC
GGCCTGTTCCGGTCAGACTACATGGTCCACCAGGACGGCTCGACGCTGCAGGCCAAACAGGTCGAGTTCAACACC
ATCGCCGCCTCCTTCGGTGGCCTCTCGGAGCACACGTCGCGCCTTCACAAATTCCTCGCCGCGACTGAGTACCCG
CTCCTGGAGCGGCCGATCGCGGCCGGCACCGCCCTCCTCGACCTGCCGGAGAACCGGCCGGTGCGGGGCCTCGCG
GCCGGTCTGCGGGCCGCCCACGCCGCGTACGCGCCCTCGGAGGAGCTGGGGCTCCCGACCTGCGTCCTGTTCGTG
GTCCAGGCCGGCGAGCGCAACGTCTTCGACCAGCGCCACCTGGAGTACGAGCTCGCGACGACGACGCGCCTGTTC
CGGCTCGCCCTCGCCGACGTCGCCGCCCACACCTCCGTCGCCGACACCGCCCGGCGCCAGCTCCTCTACCGCCAC
GGCCCGTCCGGAAGGCATTTCGAGGTTGCCGTCGTCTACCTGCGCGCCGGCTACGGCCCGGCCGACTACCCCGAC
CGCCGCGCCTGGGAGGCCCGGTACCGGCTTGAGCGCTCCGCCGCCATCAAGTGCCCGTCGGTGCTGACGCAGCTG
GCCGGCGCCAAGAAGGTCCAGCAGCTGCTCGCCGCAGCCGGGGCGCTCGGCCGGTTCCTCCGCGACGCCGACGAC
GACGGCTCGTCGCCAGCCGTCGCCGCGCTGCGCCGCACCTTCACCAACATCTACCCCATGGACGCCGCCTCCCCG
GCCGGGCGCGAGGCCCGCGCCAGGGCCCTGGACCCGGACCGCTGCGCCGCCTACGTGCTCAAGCCGCAGCGCGAG
GGCGGCGGCAACAACACGTACCGGGCCGCCATCCCGGCCTTCCTCCGGTCCGTGCCCGAGGAGCACTGGCCGTCC
TTCATCCTCATGGAGCTCATTACGCCGCCGCCCGTGTCGAACCTCATCCTGCGCAACGGCGCGGTCGAGCAGGGC
GGCGTCATCTGCGAGCTCGGCGTCTACGGCACCTGTCTCTGGCACCAGCGCACCGGCGAGCTGCTGCACAACGAC
GAGGCCGGCCACCTGCTGCGCACCAAGGGCGACCAGAGCGAGGAGGGCGGCGTGGCGGCGGGATACGGATGCATG
GACAGCTGCGCCCTGGTTTGA
Gene >Hirsu2|630
ATGGACGCCTATCCTCCTCCCCTGACCGAGGCCGAGCGGGACGGCCTCGTCCAGGCCGTCAAGGACTGGTCTATG
GCCAACGGGCTGGCGGTCCGGACGCCGCCGGCCGTCCTTCCCGCCGAGGCCGACCCGGCCGGCATCACCGCCATC
GGCGCGCCCGTCACCCTCTTCCCGAGCCCGTTCCCGCGCGTCTGCTTCGACCAGGCCGTGGCGGTGCAGAGGACG
TACAACGAGCTCTACGCCGCCGTCAGCCGCGACGAGGACTTTCTGGCCGACGTGGTCAAGCAGTAGGCCTCGCCA
CCACCACGTGCCGGACGCCTTCTCGTCGCTGCTGACTCTCTGTCCGGGACACAGAGTCGGGGATGGAGACGACTT
CATCCAGAACCTGTGGCAGATTCACCTCAGGGTCAAGCAGGAGGGATACACGCAGGTGCCTACACACCTCTTCTT
GCTCTTCCCCCCTTCTCTCTGTTCCTGTTTCTTTCGTGTCATGCGGCCCCCTCATCATGGCTAATAGCGAGATAG
CCGCTCTCCCTCGGCCTGTTCCGGTCAGACTACATGGTCCACCAGGACGGCTCGACGCTGCAGGCCAAACAGGTC
GAGTTCAACACCATCGCCGCCTCCTTCGGTGGCCTCTCGGAGCACACGTCGCGCCTTCACAAGTAAGTCGACCCC
CGTTGGCCACGCCGCATCCCAGGGTCCCGACGAGGCTGACGTCGATAAGATTCCTCGCCGCGACTGAGTACCCGC
TCCTGGAGCGGCCGATCGCGGCCGGCACCGCCCTCCTCGACCTGCCGGAGAACCGGCCGGTGCGGGGCCTCGCGG
CCGGTCTGCGGGCCGCCCACGCCGCGTACGCGCCCTCGGAGGAGCTGGGGCTCCCGACCTGCGTCCTGTTCGTGG
TCCAGGCCGGCGAGCGCAACGTCTTCGACCAGCGCCACCTGGAGTACGAGCTCGCGACGACGACGCGCCTGTTCC
GGCTCGCCCTCGCCGACGTCGCCGCCCACACCTCCGTCGCCGACACCGCCCGGCGCCAGCTCCTCTACCGCCACG
GCCCGTCCGGAAGGCATTTCGAGGTTGCCGTCGTCTACCTGCGCGCCGGCTACGGCCCGGCCGACTACCCCGACC
GCCGCGCCTGGGAGGCCCGGTACCGGCTTGAGCGCTCCGCCGCCATCAAGTGCCCGTCGGTGCTGACGCAGCTGG
CCGGCGCCAAGAAGGTCCAGCAGCTGCTCGCCGCAGCCGGGGCGCTCGGCCGGTTCCTCCGCGACGCCGACGACG
ACGGCTCGTCGCCAGCCGTCGCCGCGCTGCGCCGCACCTTCACCAACATCTACCCCATGGACGCCGCCTCCCCGG
CCGGGCGCGAGGCCCGCGCCAGGGCCCTGGACCCGGACCGCTGCGCCGCCTACGTGCTCAAGCCGCAGCGCGAGG
GCGGCGGCAACAACACGTACCGGGCCGCCATCCCGGCCTTCCTCCGGTCCGTGCCCGAGGAGCACTGGCCGTCCT
TCATCCTCATGGAGCTCATTACGCCGCCGCCCGTGTCGAACCTCATCCTGCGCAACGGCGCGGTCGAGCAGGGCG
GCGTCATCTGCGAGCTCGGCGTCTACGGCACCTGTCTCTGGCACCAGCGCACCGGCGAGCTGCTGCACAACGACG
AGGCCGGCCACCTGCTGCGCACCAAGGGCGACCAGAGCGAGGAGGGCGGCGTGGCGGCGGGATACGGATGCATGG
ACAGCTGCGCCCTGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail