Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6294
Gene name
LocationContig_320:19363..20727
Strand+
Gene length (bp)1364
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02469 Fasciclin Fasciclin domain 5.8E-15 213 323

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|D4B388|FLA_ARTBC Fasciclin-like arabinogalactan protein ARB_02922 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02922 PE=3 SV=1 169 321 1.0E-15

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6294
MRVQPSAAVLVLAGIVAPAVTQSSDAGLLASLRREGASRFADFLESDPSTLDAFLRNARTVYAPSDESLARPRRR
DDTTQRLQQANYQGCQAETNLAAGSMSLPGRSEQTMLVAPKLQPQPITDSVSQKLGNSSLQVIVADSRPDNTKRW
LSRSLVQRRQSAQSWPKLCSGLGATTNIMRGGIKFDRGTIYLTDGYFTLPQSISRTVNAIGQTTFASLAAIGGLT
QQLDDMHAVTIFLPSNTALASVQAGNMSGSAAAQLASSHIVPNFVGYLPRLRDGANMRSQTGQVLKVRVVGGKYY
INDAAITQANIILDSGVAHVIDKSRSR*
Coding >Hirsu2|6294
ATGCGTGTACAGCCGTCGGCGGCCGTCCTCGTCTTGGCGGGCATCGTTGCGCCAGCAGTGACCCAGTCTTCTGAC
GCCGGCCTGTTGGCCAGTCTCAGGCGAGAGGGCGCCTCCCGGTTCGCGGACTTCCTCGAGTCTGATCCGAGCACG
TTGGATGCGTTTCTCCGGAACGCCCGGACCGTCTACGCCCCTTCTGATGAATCCCTTGCGCGCCCGAGACGGCGG
GACGACACGACGCAGAGACTGCAGCAGGCGAACTACCAGGGATGCCAGGCCGAGACAAACCTGGCGGCGGGCAGT
ATGTCTCTCCCCGGTCGATCCGAGCAGACTATGCTGGTCGCCCCAAAGCTGCAGCCGCAGCCCATCACGGATTCC
GTTTCTCAGAAGCTGGGTAACAGCAGCCTGCAAGTGATCGTGGCGGACTCGAGGCCTGATAACACCAAGCGATGG
CTCTCGCGCTCCCTCGTCCAGCGGAGGCAATCGGCCCAATCCTGGCCCAAGCTTTGTTCTGGACTCGGAGCGACG
ACCAATATCATGAGGGGGGGTATCAAGTTCGACAGGGGGACTATCTATCTTACGGACGGCTACTTCACCCTTCCC
CAGTCAATTTCCAGGACCGTCAACGCCATCGGACAGACGACGTTCGCCAGCCTGGCCGCTATCGGTGGCCTGACG
CAACAGTTGGACGACATGCACGCCGTGACCATCTTTCTGCCCTCCAATACTGCACTCGCCTCGGTTCAAGCTGGC
AACATGTCCGGCTCGGCCGCCGCCCAGCTCGCCTCCAGCCATATCGTTCCCAACTTCGTCGGCTACCTCCCCCGT
CTGAGGGACGGCGCCAACATGAGATCGCAGACTGGCCAGGTCCTAAAGGTCAGGGTCGTGGGGGGCAAGTATTAT
ATCAATGACGCCGCGATCACGCAAGCGAACATCATTCTCGACAGCGGCGTCGCCCACGTGATAGACAAGAGCAGG
TCGCGGTAG
Transcript >Hirsu2|6294
ATGCGTGTACAGCCGTCGGCGGCCGTCCTCGTCTTGGCGGGCATCGTTGCGCCAGCAGTGACCCAGTCTTCTGAC
GCCGGCCTGTTGGCCAGTCTCAGGCGAGAGGGCGCCTCCCGGTTCGCGGACTTCCTCGAGTCTGATCCGAGCACG
TTGGATGCGTTTCTCCGGAACGCCCGGACCGTCTACGCCCCTTCTGATGAATCCCTTGCGCGCCCGAGACGGCGG
GACGACACGACGCAGAGACTGCAGCAGGCGAACTACCAGGGATGCCAGGCCGAGACAAACCTGGCGGCGGGCAGT
ATGTCTCTCCCCGGTCGATCCGAGCAGACTATGCTGGTCGCCCCAAAGCTGCAGCCGCAGCCCATCACGGATTCC
GTTTCTCAGAAGCTGGGTAACAGCAGCCTGCAAGTGATCGTGGCGGACTCGAGGCCTGATAACACCAAGCGATGG
CTCTCGCGCTCCCTCGTCCAGCGGAGGCAATCGGCCCAATCCTGGCCCAAGCTTTGTTCTGGACTCGGAGCGACG
ACCAATATCATGAGGGGGGGTATCAAGTTCGACAGGGGGACTATCTATCTTACGGACGGCTACTTCACCCTTCCC
CAGTCAATTTCCAGGACCGTCAACGCCATCGGACAGACGACGTTCGCCAGCCTGGCCGCTATCGGTGGCCTGACG
CAACAGTTGGACGACATGCACGCCGTGACCATCTTTCTGCCCTCCAATACTGCACTCGCCTCGGTTCAAGCTGGC
AACATGTCCGGCTCGGCCGCCGCCCAGCTCGCCTCCAGCCATATCGTTCCCAACTTCGTCGGCTACCTCCCCCGT
CTGAGGGACGGCGCCAACATGAGATCGCAGACTGGCCAGGTCCTAAAGGTCAGGGTCGTGGGGGGCAAGTATTAT
ATCAATGACGCCGCGATCACGCAAGCGAACATCATTCTCGACAGCGGCGTCGCCCACGTGATAGACAAGAGCAGG
TCGCGGTAG
Gene >Hirsu2|6294
ATGCGTGTACAGCCGTCGGCGGCCGTCCTCGTCTTGGCGGGCATCGTTGCGCCAGCAGTGACCCAGTCTTCTGAC
GCCGGCCTGTTGGCCAGTCTCAGGCGAGAGGGCGCCTCCCGGTTCGCGGACTTCCTCGAGTCTGATCCGAGCACG
TTGGATGCGTTTCTCCGGAACGCCCGGACCGTCTACGCCCCTTCTGATGAATCCCTTGCGCGCCCGAGACGGCGG
GACGACACGACGCAGAGACTGCAGCAGGCGAACTACCAGGGATGCCAGGCCGAGACAAACCTGGCGGCGGGCAGT
ATGTCTCTCCCCGGTCGATCCGAGCAGACTATGCTGGTCGCCCCAAAGCTGCAGCCGCAGCCCATCACGGATTCC
GTTTCTCAGAAGCTGGGTAACAGCAGCCTGCAAGTGATCGTGGCGGACTCGAGGCCTGATAACACCAAGCGATGG
CTCTCGCGCTCCCTCGTCCAGCGGAGGCAATCGGCCCAATCCTGGCCCAAGCTTTGTTCTGGACTCGGAGCGACG
ACCAATATCATGAGGGGGGGTATCAAGTTCGACAGGGGGACTATCTATCTTACGGACGGGTCAGCCGCTCTGAAC
AGCCCTCGTCTTATGCCTGAATTGACTGGCTGACATGGCATCGCACCAGCTACTTCACCCTTCCCCAGTCAATTT
CCAGGACCGTCAACGCCATCGGACAGACGACGTTCGCCAGCCTGGCCGCTATCGGTGGCCTGACGCAACAGTTGG
ACGACATGCACGCCGTGACCATCTTTCTGCCCTCCAATACTGCACTCGCCTCGGTTCAAGCTGGCAACATGTCCG
GCTCGGCCGCCGCCCAGCTCGCCTCCAGCCATATCGTTCCCAACTTCGTCGGCTACCTCCCCCGTCTGAGGGACG
GCGCCAACATGAGATCGCAGACTGGCCAGGTCCTAAAGGTCAGGGTCGTGGGGGGCAAGTATTATATCAATGACG
CCGCGATCACGCAAGCGAACATCATTCTCGACAGCGGCGTCGCCCACGTGATAGACAAGGTGCGTTTTTTTTTTA
TCATCCTCTTCCTCACCCCAGTCGCCTTTGAGGCATGGAAGCTGAGAGAGACTCGCGATTCACGAATTGGCCTTG
CTTAATACAGCCTCTTGTGCCGGGTGCCGTCACCACTTCGGACGGCTGTCGGGGTCAAACGGTCGGTTTGGCCTT
GCCCATCGTCGGCGTACTCACCACTATTGCCGTCTTTTCACTCTTTTAAATGTATCCTTGTTGCATAAGGTGGAG
AATAACGAGAAGGGAGAGTTGACGAGGAATTTGTTGTAATGTCTATTCATTTCGCCTTCGCGTTACTGCGCTAGA
GCAGGTCGCGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail