Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6292
Gene name
LocationContig_320:4952..8284
Strand+
Gene length (bp)3332
Transcript length (bp)3123
Coding sequence length (bp)3123
Protein length (aa) 1041

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 9.3E-30 158 277
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 9.0E-28 819 1020
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.5E-18 397 732
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 3.1E-15 51 118
PF13246 Cation_ATPase Cation transport ATPase (P-type) 1.2E-08 458 554
PF08282 Hydrolase_3 haloacid dehalogenase-like hydrolase 2.1E-04 704 762

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 68 1025 0.0E+00
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 45 1024 0.0E+00
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 45 1024 0.0E+00
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 51 1024 0.0E+00
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 62 1024 2.0E-144
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 68 1025 0.0E+00
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 45 1024 0.0E+00
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 45 1024 0.0E+00
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 51 1024 0.0E+00
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 62 1024 2.0E-144
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 51 1024 6.0E-131
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 42 988 9.0E-130
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 42 988 9.0E-130
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 42 988 9.0E-130
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 68 1022 6.0E-127
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 64 988 1.0E-123
sp|O43108|ATC1_YARLI Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 35 997 4.0E-122
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 67 1025 2.0E-115
sp|O59868|ATC1_SCHPO Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 53 1027 3.0E-115
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 58 995 4.0E-115
sp|P37367|ATA1_SYNY3 Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 51 880 2.0E-114
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 58 995 4.0E-114
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 58 995 1.0E-113
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 53 995 3.0E-111
sp|P13586|ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 29 868 1.0E-110
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 51 1023 8.0E-109
sp|Q80XR2|AT2C1_MOUSE Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 53 995 2.0E-108
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 51 1023 2.0E-107
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 51 1023 2.0E-107
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 51 1023 2.0E-107
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 45 898 2.0E-107
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 51 898 6.0E-107
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 51 898 6.0E-107
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 37 898 9.0E-107
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 51 898 3.0E-106
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 54 996 3.0E-106
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 51 898 5.0E-106
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 51 898 7.0E-106
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 51 873 8.0E-106
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 51 898 8.0E-106
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 51 898 2.0E-105
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 51 900 3.0E-105
sp|Q9YGL9|AT2A3_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 51 1031 7.0E-105
sp|A7L9Z8|AT2C2_MOUSE Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 54 995 7.0E-105
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 51 898 2.0E-104
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 51 898 5.0E-104
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 27 898 3.0E-103
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 51 900 3.0E-103
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 51 898 3.0E-103
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 51 898 1.0E-102
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 51 900 1.0E-102
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 51 898 2.0E-102
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 51 900 2.0E-102
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 51 898 8.0E-102
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 51 900 1.0E-101
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 51 903 2.0E-101
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 51 903 4.0E-101
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 45 886 9.0E-101
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 51 898 1.0E-100
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 51 1032 2.0E-100
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 51 856 3.0E-100
sp|O75185|AT2C2_HUMAN Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 37 1023 3.0E-100
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 51 900 4.0E-100
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 51 900 5.0E-100
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 51 898 6.0E-100
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 29 898 2.0E-99
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 51 900 2.0E-99
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 51 900 3.0E-99
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 51 888 2.0E-98
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 51 900 2.0E-98
sp|Q92030|AT1A1_ANGAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 51 898 2.0E-98
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 51 900 7.0E-98
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 51 898 1.0E-97
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 51 1024 4.0E-97
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 51 900 1.0E-96
sp|Q64518|AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 51 949 3.0E-96
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 51 794 5.0E-96
sp|Q7PPA5|ATC1_ANOGA Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 51 1028 1.0E-95
sp|P18596|AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 51 949 2.0E-95
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 51 898 5.0E-95
sp|Q42883|ECAP_SOLLC Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 45 1024 8.0E-95
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 51 1033 5.0E-94
sp|Q93084|AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 51 949 6.0E-94
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 51 1025 7.0E-94
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 51 1033 1.0E-93
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 51 897 2.0E-93
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 67 1023 5.0E-93
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 51 855 5.0E-93
sp|Q9XES1|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 67 1023 3.0E-92
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 51 856 1.0E-91
sp|P70083|AT2A1_MAKNI Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 51 856 5.0E-91
sp|Q64578|AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 51 856 1.0E-90
sp|P13585|AT2A1_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 51 856 2.0E-90
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 51 856 3.0E-90
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 47 886 8.0E-90
sp|P04191|AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 51 856 1.0E-89
sp|P35316|ATC_ARTSF Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 51 1024 3.0E-89
sp|Q0VCY0|AT2A1_BOVIN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 69 856 3.0E-89
sp|P22700|ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 51 855 1.0E-87
sp|O14983|AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 69 856 2.0E-87
sp|Q292Q0|ATC1_DROPS Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 51 1025 5.0E-87
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 69 851 1.0E-86
sp|Q03669|AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 51 856 1.0E-85
sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 51 856 1.0E-84
sp|O55143|AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 51 856 1.0E-84
sp|P11507|AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 51 856 2.0E-84
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 65 1027 4.0E-84
sp|P11607|AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 51 856 4.0E-84
sp|P20647|AT2A2_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 51 856 6.0E-84
sp|O46674|AT2A2_CANLF Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 51 856 7.0E-84
sp|Q00779|AT2A2_FELCA Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 51 856 1.0E-83
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 81 1026 2.0E-82
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 58 873 6.0E-77
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 58 854 6.0E-77
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 124 880 1.0E-76
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 58 873 3.0E-76
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 124 873 1.0E-73
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 58 882 2.0E-73
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 51 873 3.0E-73
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 56 874 1.0E-72
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 56 869 1.0E-72
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 56 869 1.0E-72
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 58 854 2.0E-72
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 58 890 3.0E-72
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 124 873 6.0E-72
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 58 888 1.0E-71
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 58 869 2.0E-71
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 143 873 2.0E-71
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 143 873 4.0E-71
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 58 854 9.0E-71
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 51 873 2.0E-70
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 62 873 2.0E-70
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 143 873 4.0E-70
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 143 873 6.0E-70
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 58 869 2.0E-69
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 56 854 3.0E-69
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 143 873 4.0E-69
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 58 854 1.0E-68
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 123 1009 1.0E-67
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 61 854 6.0E-67
sp|P0ABB8|ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 53 895 6.0E-66
sp|P0ABB9|ATMA_ECO57 Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 53 895 6.0E-66
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 52 836 2.0E-62
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 300 880 2.0E-62
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 272 873 3.0E-62
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 27 856 4.0E-62
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 53 895 2.0E-61
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 53 895 2.0E-61
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 353 854 2.0E-55
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 357 873 2.0E-54
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 62 827 2.0E-53
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 62 827 1.0E-52
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 60 827 3.0E-52
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 357 873 8.0E-51
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 62 771 9.0E-50
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 67 778 2.0E-49
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 40 827 3.0E-49
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 123 877 9.0E-49
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 67 794 9.0E-49
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 67 778 3.0E-48
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 527 1024 4.0E-48
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 62 827 1.0E-47
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 122 778 3.0E-47
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 67 778 4.0E-47
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 67 778 5.0E-47
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 122 778 8.0E-47
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 67 778 1.0E-46
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 67 778 1.0E-46
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 67 778 2.0E-46
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 67 778 2.0E-46
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 102 848 5.0E-46
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 102 848 5.0E-46
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 62 737 1.0E-45
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 29 778 2.0E-45
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 67 778 8.0E-45
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 67 778 7.0E-44
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 62 737 9.0E-44
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 170 832 6.0E-43
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 67 778 1.0E-42
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 51 403 7.0E-40
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 27 778 1.0E-38
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 69 807 1.0E-32
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 66 410 6.0E-32
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 66 410 1.0E-31
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 69 853 1.0E-30
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 69 769 2.0E-30
sp|P23980|PMA2_SOLLC Plasma membrane ATPase 2 (Fragment) OS=Solanum lycopersicum GN=LHA2 PE=3 SV=1 356 778 2.0E-30
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 67 807 8.0E-30
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 67 410 2.0E-29
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 69 769 2.0E-28
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 51 857 1.0E-27
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 68 406 3.0E-26
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 69 853 1.0E-24
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 546 778 1.0E-24
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 546 778 2.0E-24
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 67 410 3.0E-24
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 67 410 5.0E-24
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 98 866 9.0E-23
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 67 410 1.0E-21
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 83 769 8.0E-21
sp|O43861|ATP9B_HUMAN Probable phospholipid-transporting ATPase IIB OS=Homo sapiens GN=ATP9B PE=2 SV=4 128 755 1.0E-20
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 546 778 3.0E-20
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 546 778 3.0E-20
sp|P90747|AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans GN=catp-8 PE=3 SV=3 164 737 6.0E-20
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 514 778 7.0E-20
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 41 410 3.0E-19
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 69 657 2.0E-18
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 321 754 3.0E-18
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 128 755 3.0E-18
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 610 777 4.0E-18
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 128 755 8.0E-18
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 128 755 1.0E-17
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 610 777 7.0E-17
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 128 755 7.0E-17
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 511 852 1.0E-16
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 511 852 1.0E-16
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 511 852 1.0E-16
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 69 737 2.0E-16
sp|Q9HD20|AT131_HUMAN Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 164 737 2.0E-16
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 51 807 2.0E-16
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 380 750 5.0E-16
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 607 841 8.0E-16
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 547 813 2.0E-15
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 602 771 2.0E-15
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 607 841 2.0E-15
sp|Q9EPE9|AT131_MOUSE Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 164 737 2.0E-15
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 607 841 2.0E-15
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 607 841 2.0E-15
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 607 841 2.0E-15
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 607 841 2.0E-15
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 607 841 2.0E-15
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 64 657 3.0E-15
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 607 841 3.0E-15
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 607 841 3.0E-15
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 607 841 3.0E-15
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 609 825 7.0E-15
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 482 776 7.0E-15
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 611 777 8.0E-15
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 584 777 1.0E-14
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 610 776 1.0E-14
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 607 776 1.0E-14
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 547 784 2.0E-14
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 610 841 2.0E-14
sp|Q926K7|KDPB2_LISIN Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 607 771 4.0E-14
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 58 266 5.0E-14
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 610 770 5.0E-14
sp|Q9LT02|PDR2_ARATH Probable manganese-transporting ATPase PDR2 OS=Arabidopsis thaliana GN=PDR2 PE=1 SV=1 119 737 5.0E-14
sp|Q93MV5|KDPB_MYXXA Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 572 771 1.0E-13
sp|P98205|ALA2_ARATH Phospholipid-transporting ATPase 2 OS=Arabidopsis thaliana GN=ALA2 PE=1 SV=1 389 750 1.0E-13
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 610 776 1.0E-13
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 610 776 2.0E-13
sp|Q9X8Z9|KDPB_STRCO Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 597 771 3.0E-13
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 607 815 3.0E-13
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 521 860 5.0E-13
sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 607 782 5.0E-13
sp|Q57RN0|KDPB_SALCH Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 602 830 5.0E-13
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 435 761 6.0E-13
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 607 777 7.0E-13
sp|B4U8E4|KDPB_HYDS0 Potassium-transporting ATPase ATP-binding subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=kdpB PE=3 SV=1 607 771 7.0E-13
sp|Q9R6X1|KDPB_ANASL Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 628 841 9.0E-13
sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 607 810 1.0E-12
sp|P70704|AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus GN=Atp8a1 PE=1 SV=2 389 866 1.0E-12
sp|Q8YPE9|KDPB1_NOSS1 Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 628 841 1.0E-12
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 607 782 2.0E-12
sp|Q8K2X1|AT10D_MOUSE Probable phospholipid-transporting ATPase VD OS=Mus musculus GN=Atp10d PE=2 SV=2 521 860 2.0E-12
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 602 777 3.0E-12
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 602 777 3.0E-12
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 607 810 4.0E-12
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 118 409 5.0E-12
sp|Q8R8I6|KDPB_CALS4 Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 609 771 5.0E-12
sp|P57699|KDPB_HALSA Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 607 771 5.0E-12
sp|B0R9M0|KDPB_HALS3 Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 607 771 5.0E-12
sp|Q8XU11|KDPB_RALSO Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 607 771 7.0E-12
sp|Q9CCL1|CTPC_MYCLE Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 608 758 7.0E-12
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 607 777 7.0E-12
sp|O32328|KDPB_CLOAB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 607 771 8.0E-12
sp|Q9Y2Q0|AT8A1_HUMAN Phospholipid-transporting ATPase IA OS=Homo sapiens GN=ATP8A1 PE=1 SV=1 389 866 8.0E-12
sp|P73867|KDPB_SYNY3 Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 610 771 1.0E-11
sp|Q9RZP0|KDPB_DEIRA Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 607 771 1.0E-11
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 610 777 2.0E-11
sp|Q9X5V3|ATCU_RHILV Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 610 773 3.0E-11
sp|B4SZB1|KDPB_SALNS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 602 830 3.0E-11
sp|B5BCA4|KDPB_SALPK Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 602 830 3.0E-11
sp|Q5PCJ7|KDPB_SALPA Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 602 830 3.0E-11
sp|B5R670|KDPB_SALG2 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 602 830 3.0E-11
sp|Q9A7X7|KDPB_CAUCR Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 608 771 3.0E-11
sp|B4TQ22|KDPB_SALSV Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 602 830 3.0E-11
sp|B5FNE0|KDPB_SALDC Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 602 830 3.0E-11
sp|A9MUE0|KDPB_SALPB Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 602 830 3.0E-11
sp|B4TBA6|KDPB_SALHS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 602 830 4.0E-11
sp|B5QWE9|KDPB_SALEP Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 602 830 4.0E-11
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 486 794 4.0E-11
sp|Q8Z8E5|KDPB_SALTI Putative potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhi GN=kdpB PE=5 SV=1 602 830 4.0E-11
sp|A4SZG8|KDPB_POLSQ Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 602 771 5.0E-11
sp|B5EZE3|KDPB_SALA4 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 602 830 5.0E-11
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 610 777 5.0E-11
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 610 777 5.0E-11
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 610 777 5.0E-11
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 610 777 5.0E-11
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 610 777 5.0E-11
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 610 777 5.0E-11
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 610 777 6.0E-11
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 610 777 6.0E-11
sp|Q8NVI2|KDPB_STAAW Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 608 771 6.0E-11
sp|Q6G7N3|KDPB_STAAS Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 608 771 6.0E-11
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 610 777 6.0E-11
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 610 777 6.0E-11
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 610 777 6.0E-11
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 610 777 6.0E-11
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 610 777 6.0E-11
sp|A8Z4X9|KDPB_STAAT Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 608 771 6.0E-11
sp|A6QIS1|KDPB_STAAE Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 608 771 6.0E-11
sp|Q5HEC4|KDPB_STAAC Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 608 771 6.0E-11
sp|P63684|KDPB2_STAAN Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 608 771 6.0E-11
sp|P63683|KDPB2_STAAM Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 608 771 6.0E-11
sp|Q6GEZ7|KDPB2_STAAR Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 608 771 7.0E-11
sp|Q2YUH7|KDPB_STAAB Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 608 771 9.0E-11
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 607 777 9.0E-11
sp|A1JQS2|KDPB_YERE8 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 547 771 9.0E-11
sp|Q667S4|KDPB_YERPS Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B1LLE1|KDPB_ECOSM Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|P03960|KDPB_ECOLI Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 602 771 2.0E-10
sp|B1X6M8|KDPB_ECODH Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|C4ZWH3|KDPB_ECOBW Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B1JR96|KDPB_YERPY Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|A7FFQ9|KDPB_YERP3 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q8YSD5|KDPB2_NOSS1 Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 604 771 2.0E-10
sp|A7ZXV8|KDPB_ECOHS Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|A4TL06|KDPB_YERPP Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q1CKH2|KDPB_YERPN Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|A9R3X3|KDPB_YERPG Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q8ZD97|KDPB_YERPE Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B2KA78|KDPB_YERPB Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q1C586|KDPB_YERPA Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|A6T6D8|KDPB_KLEP7 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B6HYQ5|KDPB_ECOSE Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|A7ZJ80|KDPB_ECO24 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B7NMQ0|KDPB_ECO7I Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B5XZE9|KDPB_KLEP3 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q3Z4A6|KDPB_SHISS Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B7N9U0|KDPB_ECOLU Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B1IY32|KDPB_ECOLC Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B5YQN9|KDPB_ECO5E Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q8X9F9|KDPB_ECO57 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q8FJV4|KDPB_ECOL6 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q0TJY9|KDPB_ECOL5 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B7UKX6|KDPB_ECO27 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 607 777 2.0E-10
sp|B7MPK0|KDPB_ECO81 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q8ZQW2|KDPB_SALTY Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 602 830 2.0E-10
sp|Q1REM0|KDPB_ECOUT Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|A1A8W1|KDPB_ECOK1 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B7MFW2|KDPB_ECO45 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|P9WPT5|CTPC_MYCTU Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 608 777 2.0E-10
sp|P9WPT4|CTPC_MYCTO Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 608 777 2.0E-10
sp|P0A503|CTPC_MYCBO Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 608 777 2.0E-10
sp|Q324L0|KDPB_SHIBS Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B7M5L3|KDPB_ECO8A Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B7LAA4|KDPB_ECO55 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|B7LKR7|KDPB_ESCF3 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 602 771 2.0E-10
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 605 775 3.0E-10
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 607 777 4.0E-10
sp|Q9P241|AT10D_HUMAN Probable phospholipid-transporting ATPase VD OS=Homo sapiens GN=ATP10D PE=2 SV=3 521 860 4.0E-10
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 602 830 4.0E-10
sp|P9WPU3|KDPB_MYCTU Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 607 771 4.0E-10
sp|P9WPU2|KDPB_MYCTO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 607 771 4.0E-10
sp|P63682|KDPB_MYCBO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 607 771 4.0E-10
sp|B2TTJ7|KDPB_SHIB3 Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 602 771 4.0E-10
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 610 792 5.0E-10
sp|C7EXK4|AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus GN=ATP8A2 PE=1 SV=4 319 855 5.0E-10
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 607 771 6.0E-10
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 607 771 6.0E-10
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 607 771 6.0E-10
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 607 771 6.0E-10
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 607 771 6.0E-10
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 607 777 6.0E-10
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 610 777 7.0E-10
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 610 777 7.0E-10
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 607 777 7.0E-10
sp|Q7N6W6|KDPB_PHOLL Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 602 771 7.0E-10
sp|Q0TRT3|KDPB_CLOP1 Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 547 771 7.0E-10
sp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 602 770 7.0E-10
sp|C4LDL7|KDPB_TOLAT Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 602 771 7.0E-10
sp|O32219|CADA_BACSU Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 568 770 7.0E-10
sp|Q47H39|KDPB_DECAR Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 602 771 7.0E-10
sp|Q8U9D9|KDPB_AGRFC Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 539 771 8.0E-10
sp|Q927G0|KDPB1_LISIN Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 607 771 8.0E-10
sp|Q71W90|KDPB_LISMF Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 607 771 8.0E-10
sp|C1KZN5|KDPB_LISMC Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 607 771 8.0E-10
sp|B8DAW1|KDPB_LISMH Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 607 771 8.0E-10
sp|A0AM16|KDPB_LISW6 Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 607 771 9.0E-10
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 62 221 1.0E-09
sp|P55989|COPA_HELPY Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 599 777 1.0E-09
sp|Q8Y3Z7|KDPB_LISMO Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 607 771 1.0E-09
sp|A4W860|KDPB_ENT38 Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 602 771 1.0E-09
sp|Q59467|COPA2_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 599 777 1.0E-09
sp|B2VJK3|KDPB_ERWT9 Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 602 771 2.0E-09
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 607 777 3.0E-09
sp|Q59998|ATZN_SYNY3 Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 572 770 3.0E-09
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 611 777 3.0E-09
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 611 777 3.0E-09
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 124 272 4.0E-09
sp|P77871|COPA1_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 603 777 4.0E-09
sp|P57698|KDPB_PSEAE Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 607 771 4.0E-09
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 607 771 4.0E-09
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 611 777 5.0E-09
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 108 408 5.0E-09
sp|P59219|KDPB_LEPIN Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 607 771 6.0E-09
sp|Q72TM6|KDPB_LEPIC Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 607 771 7.0E-09
sp|Q9ZM69|COPA_HELPJ Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 603 777 7.0E-09
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 124 272 8.0E-09
sp|Q8NB49|AT11C_HUMAN Phospholipid-transporting ATPase IG OS=Homo sapiens GN=ATP11C PE=1 SV=3 389 652 8.0E-09
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 108 408 8.0E-09
sp|Q8KU73|KDPB_ENTFA Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 607 771 9.0E-09
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 383 758 9.0E-09
sp|Q9ZL53|HMCT_HELPJ Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cadA PE=3 SV=1 561 762 9.0E-09
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 124 410 1.0E-08
sp|B2V2P3|KDPB_CLOBA Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 607 771 1.0E-08
sp|B2TMJ2|KDPB_CLOBB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 607 771 1.0E-08
sp|Q98GX6|KDPB_RHILO Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 602 771 2.0E-08
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 609 776 2.0E-08
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 62 274 3.0E-08
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 609 776 3.0E-08
sp|P9WPU1|CTPA_MYCTU Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 610 758 3.0E-08
sp|P9WPU0|CTPA_MYCTO Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 610 758 3.0E-08
sp|Q8PPC9|KDPB_XANAC Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kdpB PE=3 SV=1 602 778 3.0E-08
sp|Q8PCM1|KDPB_XANCP Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 602 778 3.0E-08
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 107 411 4.0E-08
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 133 410 5.0E-08
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 133 410 5.0E-08
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 133 410 5.0E-08
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 607 761 5.0E-08
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 605 770 5.0E-08
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 108 408 6.0E-08
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 607 794 8.0E-08
sp|Q97BF6|KDPB_THEVO Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 607 771 9.0E-08
sp|Q59465|HMCT_HELPY Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cadA PE=1 SV=2 561 762 1.0E-07
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 609 776 2.0E-07
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 692 758 2.0E-07
sp|P46839|CTPA_MYCLE Cation-transporting P-type ATPase A OS=Mycobacterium leprae (strain TN) GN=ctpA PE=3 SV=2 633 758 3.0E-07
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 118 409 4.0E-07
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 607 777 4.0E-07
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 607 763 8.0E-07
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 607 763 9.0E-07
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 108 408 2.0E-06
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 522 660 2.0E-06
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 92 408 3.0E-06
sp|P9WPT9|CTPB_MYCTU Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 693 761 3.0E-06
sp|P9WPT8|CTPB_MYCTO Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 693 761 3.0E-06
sp|P59947|CTPB_MYCBO Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 693 761 3.0E-06
sp|P9WPT7|CTPJ_MYCTU Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpJ PE=2 SV=1 609 826 8.0E-06
sp|P9WPT6|CTPJ_MYCTO Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpJ PE=3 SV=1 609 826 8.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Lysosome/Vacuole Signal peptide|Transmembrane domain 0.1744 0.0905 0.0295 0.3614 0.1243 0.04 0.4606 0.6191 0.4792 0.0029

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 98 120 22
2 124 143 19
3 317 339 22
4 344 366 22
5 787 809 22
6 871 893 22
7 965 987 22
8 997 1015 18

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup75
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1037
Ophiocordyceps australis 1348a (Ghana) OphauG2|3640
Ophiocordyceps australis 1348a (Ghana) OphauG2|6793
Ophiocordyceps australis map64 (Brazil) OphauB2|1792
Ophiocordyceps australis map64 (Brazil) OphauB2|3557
Ophiocordyceps australis map64 (Brazil) OphauB2|5611
Ophiocordyceps australis map64 (Brazil) OphauB2|7255
Ophiocordyceps camponoti-floridani Ophcf2|03548
Ophiocordyceps camponoti-floridani Ophcf2|06308
Ophiocordyceps camponoti-rufipedis Ophun1|2263
Ophiocordyceps camponoti-rufipedis Ophun1|6824
Ophiocordyceps kimflemingae Ophio5|3290
Ophiocordyceps kimflemingae Ophio5|7329
Ophiocordyceps subramaniannii Hirsu2|5459
Ophiocordyceps subramaniannii Hirsu2|6292 (this protein)
Ophiocordyceps subramaniannii Hirsu2|7053

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6292
MRESVGTGTDGAKHAASSSVHSTATAAPDDDKPPPVAHPPDAAIEKPSCPHTLSAELIARRLETDPRHGLSDEEA
AVRLLRDGPNAVKAARGISLWELFLRQVANALTLVLAAVAGLSFAIDDFVEGGVVIAVIVLNIAIGLFQDYRAEQ
TIQALYALSTPRCKVVRGGRSDSIKAEALVKGDVVVLATGDVVPADLRLVQGINLAVDEAHLTGESKPMAKAPEL
VLSDPELPVGDRTNLAFLGSSVSRGRATGIVFATGMETEVGRIAKMLRRKERGDSYGRENSAVVSFLKRTWRTLR
SILGLEGTPLQVTLSKFALLLFGLAVLLALIVFSVSHWLLEDNILLYGICVGVAVIPESLLAVVTVTMAVASKAM
VKGHVIVRQMPCLEAVGGVTNVCTDKTGTLTQGRMIARTVWLREGLTGTVSRTADPYDPGKGTVTWSGSLVGSSL
DAFLSAIALCNNATVTDGRKGAETDSSSIATVFDPASLRAVGEPTEIALKVFAMRFGRASTPPDSVVAEHPFDSA
CKLMSVVCGPGPADAGPVVHTKGAVEVMLPLLDEDDDFKRAILDKAEELAAAGLRVLCAAGKVMAGPPQDALVRT
KVEQGLRFLGLAGLYDPPRPETADAVRQCRRAGISVHMVTGDHIKTAISIAYEVGILSRGPGGAPAGLVMTAADF
ASLSDDDIDALDSLPIVIARCSPLTKVRLIQALHRRRAFCVMTGDGVNDSPALKQADVGIAMGDRGSDVAKEASD
MVLTDDNFASIVTGIREGRRLADNIQKFAHALTSDNKFLLHLLMSNLAQVLLLLIGLAFKDEAGLPVFPLSPLEI
LWANLVTSSPLALGLGLEEAEPDILLRPPRSLHRSVFTLDLVRDQLVHGTIMGSLALASFMSVAYAATPEGFIAL
PNNCNVGEPGVCDLVFRARGTTFATLSFLLLVSAWEVKSSHRSLFALDPRRTGALSVFPVICHNRVLLCGVLVGF
LATFPILYIPALNTGVFKHQGLGWEWGVVFGCVAAYMVLVEVWKAVKRRLGLGVIRHRATVGGRA*
Coding >Hirsu2|6292
ATGAGAGAAAGCGTCGGGACCGGTACGGATGGTGCAAAACACGCCGCCAGCTCTTCTGTCCACTCGACGGCCACC
GCTGCCCCGGACGACGACAAGCCTCCTCCCGTAGCGCACCCGCCAGACGCCGCCATAGAGAAGCCCAGCTGTCCG
CATACGCTATCCGCGGAGCTCATCGCCCGGCGCCTCGAAACCGATCCGCGCCATGGCCTGAGCGACGAAGAGGCG
GCCGTCCGCCTGCTCCGCGACGGCCCCAACGCCGTCAAGGCTGCCAGGGGCATCTCGCTCTGGGAACTCTTCCTC
CGCCAGGTCGCCAATGCCCTGACCCTGGTCCTGGCCGCCGTCGCCGGCCTGTCCTTCGCCATCGATGATTTCGTC
GAGGGCGGAGTCGTCATCGCCGTCATCGTCCTCAATATTGCCATCGGCCTGTTCCAGGACTACCGCGCCGAGCAG
ACCATCCAGGCCTTGTATGCCCTGTCCACGCCGCGCTGCAAGGTGGTGCGCGGCGGCCGCAGCGACAGCATCAAG
GCCGAGGCGCTCGTCAAGGGGGACGTCGTCGTGCTCGCCACCGGCGACGTCGTCCCCGCCGACCTCCGTCTCGTC
CAGGGCATCAACCTCGCCGTCGACGAGGCCCACCTGACGGGCGAGTCGAAGCCCATGGCCAAGGCGCCCGAGCTG
GTCCTGAGCGACCCCGAGCTGCCCGTCGGCGACCGCACCAACCTCGCCTTCCTCGGCAGCTCCGTCTCGCGCGGC
CGCGCCACCGGCATCGTCTTCGCCACCGGCATGGAAACCGAGGTCGGCCGCATCGCCAAGATGCTGCGCCGGAAG
GAGAGGGGCGACAGCTACGGCCGCGAAAACAGCGCCGTCGTCTCCTTCTTGAAGCGCACCTGGCGCACCCTCCGC
AGCATCCTCGGCCTCGAGGGCACGCCGCTCCAGGTGACGCTGAGCAAGTTCGCCCTCCTCCTCTTCGGCCTGGCC
GTCCTGCTCGCCCTCATCGTCTTCTCCGTCAGCCACTGGCTCCTCGAGGACAACATCCTGCTCTACGGCATATGC
GTCGGTGTCGCCGTTATCCCCGAGTCGCTGCTGGCCGTCGTCACCGTCACCATGGCGGTCGCCTCCAAGGCCATG
GTCAAGGGCCATGTCATCGTGAGGCAGATGCCGTGCCTCGAGGCCGTCGGCGGCGTCACCAACGTGTGCACCGAC
AAGACGGGCACCCTCACCCAGGGGCGCATGATCGCGCGCACCGTCTGGCTCCGCGAGGGCCTCACCGGCACGGTG
AGCAGGACCGCCGACCCCTACGACCCGGGAAAGGGGACCGTCACCTGGTCCGGCTCGCTCGTGGGCAGCAGCCTC
GACGCCTTCCTCAGCGCCATCGCCCTCTGCAACAATGCGACCGTGACGGACGGCAGGAAGGGGGCGGAGACGGAC
TCGAGCAGCATCGCCACCGTCTTCGACCCGGCCAGCCTGAGGGCCGTCGGCGAGCCGACCGAGATCGCGCTCAAG
GTGTTCGCCATGCGCTTCGGGCGGGCCAGCACGCCGCCCGACAGCGTCGTGGCCGAGCACCCCTTCGACTCGGCC
TGCAAGCTCATGAGCGTCGTCTGCGGCCCCGGGCCGGCCGACGCGGGCCCCGTGGTGCACACCAAGGGCGCCGTC
GAGGTCATGCTCCCCCTCCTGGACGAGGACGACGACTTCAAGCGGGCCATACTCGACAAGGCCGAGGAGCTGGCG
GCCGCCGGGCTGCGCGTCCTGTGCGCCGCCGGCAAGGTGATGGCGGGCCCGCCCCAGGACGCCCTGGTCCGGACC
AAGGTCGAGCAGGGCCTGCGCTTCCTGGGGCTGGCGGGCCTCTACGACCCGCCGCGCCCGGAGACGGCCGACGCG
GTGCGGCAGTGCCGGCGCGCGGGGATCTCGGTGCATATGGTGACCGGAGATCACATCAAGACGGCCATCTCGATA
GCGTACGAGGTGGGCATCCTGTCGAGGGGCCCGGGCGGGGCGCCGGCGGGCCTGGTGATGACGGCGGCCGACTTC
GCGAGCCTGAGCGACGACGACATCGACGCGCTCGACTCGCTGCCCATCGTCATCGCCCGCTGCAGCCCGCTGACC
AAGGTCAGGCTCATCCAGGCGCTGCACCGGCGCCGGGCCTTTTGCGTCATGACGGGCGACGGCGTCAACGACTCG
CCGGCGCTGAAGCAGGCGGACGTGGGCATCGCCATGGGAGACCGGGGCAGCGACGTCGCCAAGGAGGCGTCGGAC
ATGGTGCTCACGGACGACAACTTTGCCTCGATTGTGACGGGCATCCGCGAGGGGAGGAGGCTGGCCGACAACATC
CAAAAGTTTGCGCACGCGCTGACGAGCGACAACAAGTTTCTCTTACATCTGCTCATGTCGAACCTGGCCCAGGTT
CTCCTGCTCCTGATCGGGCTCGCCTTCAAGGACGAGGCCGGCCTTCCCGTCTTCCCCCTGTCGCCGCTGGAGATT
CTATGGGCGAACCTGGTGACGTCGTCGCCGCTGGCGCTCGGCCTGGGCCTCGAGGAGGCGGAGCCGGACATTCTG
CTGCGGCCGCCGCGCAGCCTGCATCGCAGCGTCTTCACGCTCGACCTCGTGCGGGACCAGCTGGTGCACGGGACC
ATCATGGGGTCGCTGGCGCTGGCGTCGTTCATGTCGGTGGCGTACGCGGCCACGCCCGAGGGCTTCATCGCGCTG
CCCAACAACTGCAACGTCGGGGAGCCGGGCGTGTGCGACCTCGTCTTCCGGGCCCGGGGCACGACGTTTGCGACG
CTGAGCTTCCTGCTGCTCGTCTCGGCGTGGGAGGTGAAGAGCTCGCACCGCAGCCTGTTCGCCCTGGACCCGCGG
CGGACCGGCGCGCTCTCGGTCTTCCCGGTCATCTGCCACAACAGGGTCCTGCTGTGTGGGGTGCTGGTCGGGTTC
CTGGCGACGTTCCCCATCCTGTACATCCCGGCCCTCAACACCGGCGTCTTCAAGCACCAGGGGCTGGGCTGGGAG
TGGGGCGTGGTGTTCGGCTGCGTGGCGGCGTACATGGTGCTCGTCGAGGTCTGGAAAGCGGTCAAGCGGCGCCTC
GGCCTCGGCGTGATCCGCCACCGGGCGACTGTCGGCGGCCGGGCCTAG
Transcript >Hirsu2|6292
ATGAGAGAAAGCGTCGGGACCGGTACGGATGGTGCAAAACACGCCGCCAGCTCTTCTGTCCACTCGACGGCCACC
GCTGCCCCGGACGACGACAAGCCTCCTCCCGTAGCGCACCCGCCAGACGCCGCCATAGAGAAGCCCAGCTGTCCG
CATACGCTATCCGCGGAGCTCATCGCCCGGCGCCTCGAAACCGATCCGCGCCATGGCCTGAGCGACGAAGAGGCG
GCCGTCCGCCTGCTCCGCGACGGCCCCAACGCCGTCAAGGCTGCCAGGGGCATCTCGCTCTGGGAACTCTTCCTC
CGCCAGGTCGCCAATGCCCTGACCCTGGTCCTGGCCGCCGTCGCCGGCCTGTCCTTCGCCATCGATGATTTCGTC
GAGGGCGGAGTCGTCATCGCCGTCATCGTCCTCAATATTGCCATCGGCCTGTTCCAGGACTACCGCGCCGAGCAG
ACCATCCAGGCCTTGTATGCCCTGTCCACGCCGCGCTGCAAGGTGGTGCGCGGCGGCCGCAGCGACAGCATCAAG
GCCGAGGCGCTCGTCAAGGGGGACGTCGTCGTGCTCGCCACCGGCGACGTCGTCCCCGCCGACCTCCGTCTCGTC
CAGGGCATCAACCTCGCCGTCGACGAGGCCCACCTGACGGGCGAGTCGAAGCCCATGGCCAAGGCGCCCGAGCTG
GTCCTGAGCGACCCCGAGCTGCCCGTCGGCGACCGCACCAACCTCGCCTTCCTCGGCAGCTCCGTCTCGCGCGGC
CGCGCCACCGGCATCGTCTTCGCCACCGGCATGGAAACCGAGGTCGGCCGCATCGCCAAGATGCTGCGCCGGAAG
GAGAGGGGCGACAGCTACGGCCGCGAAAACAGCGCCGTCGTCTCCTTCTTGAAGCGCACCTGGCGCACCCTCCGC
AGCATCCTCGGCCTCGAGGGCACGCCGCTCCAGGTGACGCTGAGCAAGTTCGCCCTCCTCCTCTTCGGCCTGGCC
GTCCTGCTCGCCCTCATCGTCTTCTCCGTCAGCCACTGGCTCCTCGAGGACAACATCCTGCTCTACGGCATATGC
GTCGGTGTCGCCGTTATCCCCGAGTCGCTGCTGGCCGTCGTCACCGTCACCATGGCGGTCGCCTCCAAGGCCATG
GTCAAGGGCCATGTCATCGTGAGGCAGATGCCGTGCCTCGAGGCCGTCGGCGGCGTCACCAACGTGTGCACCGAC
AAGACGGGCACCCTCACCCAGGGGCGCATGATCGCGCGCACCGTCTGGCTCCGCGAGGGCCTCACCGGCACGGTG
AGCAGGACCGCCGACCCCTACGACCCGGGAAAGGGGACCGTCACCTGGTCCGGCTCGCTCGTGGGCAGCAGCCTC
GACGCCTTCCTCAGCGCCATCGCCCTCTGCAACAATGCGACCGTGACGGACGGCAGGAAGGGGGCGGAGACGGAC
TCGAGCAGCATCGCCACCGTCTTCGACCCGGCCAGCCTGAGGGCCGTCGGCGAGCCGACCGAGATCGCGCTCAAG
GTGTTCGCCATGCGCTTCGGGCGGGCCAGCACGCCGCCCGACAGCGTCGTGGCCGAGCACCCCTTCGACTCGGCC
TGCAAGCTCATGAGCGTCGTCTGCGGCCCCGGGCCGGCCGACGCGGGCCCCGTGGTGCACACCAAGGGCGCCGTC
GAGGTCATGCTCCCCCTCCTGGACGAGGACGACGACTTCAAGCGGGCCATACTCGACAAGGCCGAGGAGCTGGCG
GCCGCCGGGCTGCGCGTCCTGTGCGCCGCCGGCAAGGTGATGGCGGGCCCGCCCCAGGACGCCCTGGTCCGGACC
AAGGTCGAGCAGGGCCTGCGCTTCCTGGGGCTGGCGGGCCTCTACGACCCGCCGCGCCCGGAGACGGCCGACGCG
GTGCGGCAGTGCCGGCGCGCGGGGATCTCGGTGCATATGGTGACCGGAGATCACATCAAGACGGCCATCTCGATA
GCGTACGAGGTGGGCATCCTGTCGAGGGGCCCGGGCGGGGCGCCGGCGGGCCTGGTGATGACGGCGGCCGACTTC
GCGAGCCTGAGCGACGACGACATCGACGCGCTCGACTCGCTGCCCATCGTCATCGCCCGCTGCAGCCCGCTGACC
AAGGTCAGGCTCATCCAGGCGCTGCACCGGCGCCGGGCCTTTTGCGTCATGACGGGCGACGGCGTCAACGACTCG
CCGGCGCTGAAGCAGGCGGACGTGGGCATCGCCATGGGAGACCGGGGCAGCGACGTCGCCAAGGAGGCGTCGGAC
ATGGTGCTCACGGACGACAACTTTGCCTCGATTGTGACGGGCATCCGCGAGGGGAGGAGGCTGGCCGACAACATC
CAAAAGTTTGCGCACGCGCTGACGAGCGACAACAAGTTTCTCTTACATCTGCTCATGTCGAACCTGGCCCAGGTT
CTCCTGCTCCTGATCGGGCTCGCCTTCAAGGACGAGGCCGGCCTTCCCGTCTTCCCCCTGTCGCCGCTGGAGATT
CTATGGGCGAACCTGGTGACGTCGTCGCCGCTGGCGCTCGGCCTGGGCCTCGAGGAGGCGGAGCCGGACATTCTG
CTGCGGCCGCCGCGCAGCCTGCATCGCAGCGTCTTCACGCTCGACCTCGTGCGGGACCAGCTGGTGCACGGGACC
ATCATGGGGTCGCTGGCGCTGGCGTCGTTCATGTCGGTGGCGTACGCGGCCACGCCCGAGGGCTTCATCGCGCTG
CCCAACAACTGCAACGTCGGGGAGCCGGGCGTGTGCGACCTCGTCTTCCGGGCCCGGGGCACGACGTTTGCGACG
CTGAGCTTCCTGCTGCTCGTCTCGGCGTGGGAGGTGAAGAGCTCGCACCGCAGCCTGTTCGCCCTGGACCCGCGG
CGGACCGGCGCGCTCTCGGTCTTCCCGGTCATCTGCCACAACAGGGTCCTGCTGTGTGGGGTGCTGGTCGGGTTC
CTGGCGACGTTCCCCATCCTGTACATCCCGGCCCTCAACACCGGCGTCTTCAAGCACCAGGGGCTGGGCTGGGAG
TGGGGCGTGGTGTTCGGCTGCGTGGCGGCGTACATGGTGCTCGTCGAGGTCTGGAAAGCGGTCAAGCGGCGCCTC
GGCCTCGGCGTGATCCGCCACCGGGCGACTGTCGGCGGCCGGGCCTAG
Gene >Hirsu2|6292
ATGAGAGAAAGCGTCGGGACCGGTACGGATGGTGCAAAACACGCCGCCAGCTCTTCTGTCCACTCGACGGCCACC
GCTGCCCCGGACGACGACAAGCCTCCTCCCGTAGCGCACCCGCCAGACGCCGCCATAGAGAAGCCCAGCTGTCCG
CATACGCTATCCGCGGAGCTCATCGCCCGGCGCCTCGAAACCGATCCGCGCCATGGCCTGAGCGACGAAGAGGCG
GCCGTCCGCCTGCTCCGCGACGGCCCCAACGCCGTCAAGGCTGCCAGGGGCATCTCGCTCTGGGAACTCTTCCTC
CGCCAGGTCGCCAATGCCCTGACCCTGGTCCTGGCCGCCGTCGCCGGCCTGTCCTTCGCCATCGATGATTTCGTC
GAGGGCGGAGTCGTCATCGCCGTCATCGTCCTCAATATTGCCATCGGGTAGGTGAGCAGTGCTCCGGGGCCCAGA
TTCACTCCTTCTTTCCCACCCGCCAGCACGGCCACCCAAGGACGAGCCTCTCGGCGTCTTTTCCTTGCGGCTGAC
CTGACGCTTCCACGCGCACAAGCCTGTTCCAGGACTACCGCGCCGAGCAGACCATCCAGGCCTTGTATGCCCTGT
CCACGCCGCGCTGCAAGGTGGTGCGCGGCGGCCGCAGCGACAGCATCAAGGCCGAGGCGCTCGTCAAGGGGGACG
TCGTCGTGCTCGCCACCGGCGACGTCGTCCCCGCCGACCTCCGTCTCGTCCAGGGCATCAACCTCGCCGTCGACG
AGGCCCACCTGACGGGCGAGTCGAAGCCCATGGCCAAGGCGCCCGAGCTGGTCCTGAGCGACCCCGAGCTGCCCG
TCGGCGACCGCACCAACCTCGCCTTCCTCGGCAGCTCCGTCTCGCGCGGCCGCGCCACCGGCATCGTCTTCGCCA
CCGGCATGGAAACCGAGGTCGGCCGCATCGCCAAGATGCTGCGCCGGAAGGAGAGGGGCGACAGCTACGGCCGCG
AAAACAGCGCCGTCGTCTCCTTCTTGAAGCGCACCTGGCGCACCCTCCGCAGCATCCTCGGCCTCGAGGGCACGC
CGCTCCAGGTGACGCTGAGCAAGTTCGCCCTCCTCCTCTTCGGCCTGGCCGTCCTGCTCGCCCTCATCGTCTTCT
CCGTCAGCCACTGGCTCCTCGAGGACAACATCCTGCTCTACGGCATATGCGTCGGTGTCGCCGTTATCCCCGAGT
CGCTGCTGGCCGTCGTCACCGTCACCATGGCGGTCGCCTCCAAGGCCATGGTCAAGGGCCATGTCATCGTGAGGC
AGATGCCGTGCCTCGAGGCCGTCGGCGGCGTCACCAACGTGTGCACCGACAAGACGGGCACCCTCACCCAGGGGC
GCATGATCGCGCGCACCGTCTGGCTCCGCGAGGGCCTCACCGGCACGGTGAGCAGGACCGCCGACCCCTACGACC
CGGGAAAGGGGACCGTCACCTGGTCCGGCTCGCTCGTGGGCAGCAGCCTCGACGCCTTCCTCAGCGCCATCGCCC
TCTGCAACAATGCGACCGTGACGGACGGCAGGAAGGGGGCGGAGACGGACTCGAGCAGCATCGCCACCGTCTTCG
ACCCGGCCAGCCTGAGGGCCGTCGGCGAGCCGACCGAGATCGCGCTCAAGGTGTTCGCCATGCGCTTCGGGCGGG
CCAGCACGCCGCCCGACAGCGTCGTGGCCGAGCACCCCTTCGACTCGGCCTGCAAGCTCATGAGCGTCGTCTGCG
GCCCCGGGCCGGCCGACGCGGGCCCCGTGGTGCACACCAAGGGCGCCGTCGAGGTCATGCTCCCCCTCCTGGACG
AGGACGACGACTTCAAGCGGGCCATACTCGACAAGGCCGAGGAGCTGGCGGCCGCCGGGCTGCGCGTCCTGTGCG
CCGCCGGCAAGGTGATGGCGGGCCCGCCCCAGGACGCCCTGGTCCGGACCAAGGTCGAGCAGGGCCTGCGCTTCC
TGGGGCTGGCGGGCCTCTACGACCCGCCGCGCCCGGAGACGGCCGACGCGGTGCGGCAGTGCCGGCGCGCGGGGA
TCTCGGTGCATATGGTGACCGGAGATCACATCAAGACGGCCATCTCGATAGCGTACGAGGTGGGCATCCTGTCGA
GGGGCCCGGGCGGGGCGCCGGCGGGCCTGGTGATGACGGCGGCCGACTTCGCGAGCCTGAGCGACGACGACATCG
ACGCGCTCGACTCGCTGCCCATCGTCATCGCCCGCTGCAGCCCGCTGACCAAGGTCAGGCTCATCCAGGCGCTGC
ACCGGCGCCGGGCCTTTTGCGTCATGACGGGCGACGGCGTCAACGACTCGCCGGCGCTGAAGCAGGCGGACGTGG
GCATCGCCATGGGAGACCGGGGCAGCGACGTCGCCAAGGAGGCGTCGGACATGGTGCTCACGGACGACAACTTTG
CCTCGATTGTGACGGGCATCCGCGAGGGGAGGAGGCTGGCCGACAACATCCAAAAGGTATGTGTACAGATGTGTG
CATACACACACGCGCACGCACGCCTCGCTGCCTCTCACGTTTTTCCTTTACACGCCCCCTCACAGTTTGCGCACG
CGCTGACGAGCGACAACAAGTTTCTCTTACATCTGCTCATGTCGAACCTGGCCCAGGTTCTCCTGCTCCTGATCG
GGCTCGCCTTCAAGGACGAGGCCGGCCTTCCCGTCTTCCCCCTGTCGCCGCTGGAGATTCTATGGGCGAACCTGG
TGACGTCGTCGCCGCTGGCGCTCGGCCTGGGCCTCGAGGAGGCGGAGCCGGACATTCTGCTGCGGCCGCCGCGCA
GCCTGCATCGCAGCGTCTTCACGCTCGACCTCGTGCGGGACCAGCTGGTGCACGGGACCATCATGGGGTCGCTGG
CGCTGGCGTCGTTCATGTCGGTGGCGTACGCGGCCACGCCCGAGGGCTTCATCGCGCTGCCCAACAACTGCAACG
TCGGGGAGCCGGGCGTGTGCGACCTCGTCTTCCGGGCCCGGGGCACGACGTTTGCGACGCTGAGCTTCCTGCTGC
TCGTCTCGGCGTGGGAGGTGAAGAGCTCGCACCGCAGCCTGTTCGCCCTGGACCCGCGGCGGACCGGCGCGCTCT
CGGTCTTCCCGGTCATCTGCCACAACAGGGTCCTGCTGTGTGGGGTGCTGGTCGGGTTCCTGGCGACGTTCCCCA
TCCTGTACATCCCGGCCCTCAACACCGGCGTCTTCAAGCACCAGGGGCTGGGCTGGGAGTGGGGCGTGGTGTTCG
GCTGCGTGGCGGCGTACATGGTGCTCGTCGAGGTCTGGAAAGCGGTCAAGCGGCGCCTCGGCCTCGGCGTGATCC
GCCACCGGGCGACTGTCGGCGGCCGGGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail