Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6291
Gene name
LocationContig_320:31..900
Strand+
Gene length (bp)869
Transcript length (bp)672
Coding sequence length (bp)672
Protein length (aa) 224

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06807 Clp1 Pre-mRNA cleavage complex II protein Clp1 1.4E-24 116 216
PF16575 CLP1_P mRNA cleavage and polyadenylation factor CLP1 P-loop 1.8E-10 2 109

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|A6S936|CLP1_BOTFB mRNA cleavage and polyadenylation factor clp1 OS=Botryotinia fuckeliana (strain B05.10) GN=clp1 PE=3 SV=1 1 223 5.0E-69
sp|A4QQE0|CLP1_MAGO7 mRNA cleavage and polyadenylation factor CLP1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLP1 PE=3 SV=2 1 223 1.0E-68
sp|Q2H1L0|CLP1_CHAGB mRNA cleavage and polyadenylation factor CLP1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CLP1 PE=3 SV=1 1 223 8.0E-68
sp|Q7SAB7|CLP1_NEUCR mRNA cleavage and polyadenylation factor clp1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-7 PE=3 SV=1 15 222 1.0E-60
sp|Q0U2G5|CLP1_PHANO mRNA cleavage and polyadenylation factor CLP1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CLP1 PE=3 SV=1 1 223 2.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|A6S936|CLP1_BOTFB mRNA cleavage and polyadenylation factor clp1 OS=Botryotinia fuckeliana (strain B05.10) GN=clp1 PE=3 SV=1 1 223 5.0E-69
sp|A4QQE0|CLP1_MAGO7 mRNA cleavage and polyadenylation factor CLP1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CLP1 PE=3 SV=2 1 223 1.0E-68
sp|Q2H1L0|CLP1_CHAGB mRNA cleavage and polyadenylation factor CLP1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=CLP1 PE=3 SV=1 1 223 8.0E-68
sp|Q7SAB7|CLP1_NEUCR mRNA cleavage and polyadenylation factor clp1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-7 PE=3 SV=1 15 222 1.0E-60
sp|Q0U2G5|CLP1_PHANO mRNA cleavage and polyadenylation factor CLP1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=CLP1 PE=3 SV=1 1 223 2.0E-37
sp|Q0CEZ9|CLP1_ASPTN mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=clp1 PE=3 SV=2 1 223 2.0E-35
sp|A1CB93|CLP1_ASPCL mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=clp1 PE=3 SV=1 1 223 4.0E-35
sp|A2RAW3|CLP1_ASPNC mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=clp1 PE=3 SV=1 1 207 2.0E-34
sp|Q1DKL9|CLP1_COCIM mRNA cleavage and polyadenylation factor CLP1 OS=Coccidioides immitis (strain RS) GN=CLP1 PE=3 SV=2 1 223 7.0E-30
sp|Q6BZT5|CLP1_YARLI mRNA cleavage and polyadenylation factor CLP1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CLP1 PE=3 SV=1 1 212 1.0E-27
sp|Q10299|CLP1_SCHPO mRNA cleavage and polyadenylation factor clp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=clp1 PE=3 SV=1 1 216 4.0E-26
sp|A3LNJ3|CLP1_PICST mRNA cleavage and polyadenylation factor CLP1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=CLP1 PE=3 SV=3 1 210 2.0E-23
sp|A7TH62|CLP1_VANPO mRNA cleavage and polyadenylation factor CLP1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CLP1 PE=3 SV=1 1 214 5.0E-23
sp|Q59ST8|CLP1_CANAL mRNA cleavage and polyadenylation factor CLP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CLP1 PE=3 SV=1 1 210 7.0E-23
sp|Q6CTU5|CLP1_KLULA mRNA cleavage and polyadenylation factor CLP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=CLP1 PE=3 SV=1 1 214 3.0E-20
sp|Q08685|CLP1_YEAST mRNA cleavage and polyadenylation factor CLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CLP1 PE=1 SV=1 1 210 2.0E-19
sp|A6ZP88|CLP1_YEAS7 mRNA cleavage and polyadenylation factor CLP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=CLP1 PE=3 SV=1 1 210 2.0E-19
sp|Q6BU98|CLP1_DEBHA mRNA cleavage and polyadenylation factor CLP1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=CLP1 PE=3 SV=2 1 210 3.0E-19
sp|A1DE49|CLP1_NEOFI mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=clp1 PE=3 SV=1 1 132 1.0E-18
sp|Q2UEA6|CLP1_ASPOR mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=clp1 PE=3 SV=1 1 132 6.0E-18
sp|Q9SR06|CLP1_ARATH Protein CLP1 homolog OS=Arabidopsis thaliana GN=CLPS3 PE=1 SV=1 1 212 7.0E-18
sp|Q4P9Z3|CLP1_USTMA mRNA cleavage and polyadenylation factor CLP1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CLP1 PE=3 SV=1 1 212 1.0E-17
sp|Q75F23|CLP1_ASHGO mRNA cleavage and polyadenylation factor CLP1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=CLP1 PE=3 SV=1 1 214 8.0E-17
sp|Q6FMC8|CLP1_CANGA mRNA cleavage and polyadenylation factor CLP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=CLP1 PE=3 SV=1 1 210 9.0E-17
sp|A5DJW8|CLP1_PICGU mRNA cleavage and polyadenylation factor CLP1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=CLP1 PE=3 SV=2 1 200 9.0E-17
sp|Q5BH19|CLP1_EMENI mRNA cleavage and polyadenylation factor clp1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clp1 PE=3 SV=2 152 223 1.0E-16
sp|A1DE49|CLP1_NEOFI mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=clp1 PE=3 SV=1 150 223 8.0E-16
sp|Q7QJW7|CLP1_ANOGA Protein CLP1 homolog OS=Anopheles gambiae GN=cbc PE=3 SV=2 1 199 9.0E-16
sp|Q5BH19|CLP1_EMENI mRNA cleavage and polyadenylation factor clp1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=clp1 PE=3 SV=2 1 132 1.0E-15
sp|Q4WVA5|CLP1_ASPFU mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clp1 PE=3 SV=1 150 223 2.0E-15
sp|B0Y0Y6|CLP1_ASPFC mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=clp1 PE=3 SV=1 150 223 3.0E-15
sp|Q54N48|CLP1_DICDI Protein CLP1 homolog OS=Dictyostelium discoideum GN=clp1 PE=3 SV=1 1 216 4.0E-15
sp|B4HQJ2|CLP1_DROSE Protein CLP1 homolog OS=Drosophila sechellia GN=cbc PE=3 SV=1 1 199 6.0E-15
sp|A5DY33|CLP1_LODEL mRNA cleavage and polyadenylation factor CLP1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=CLP1 PE=3 SV=1 3 202 6.0E-15
sp|Q16WA6|CLP1_AEDAE Protein CLP1 homolog OS=Aedes aegypti GN=cbc PE=3 SV=1 1 199 1.0E-14
sp|B4KML2|CLP1_DROMO Protein CLP1 homolog OS=Drosophila mojavensis GN=cbc PE=3 SV=1 1 199 2.0E-14
sp|B4P4H2|CLP1_DROYA Protein CLP1 homolog OS=Drosophila yakuba GN=cbc PE=3 SV=1 9 199 2.0E-14
sp|Q4WVA5|CLP1_ASPFU mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=clp1 PE=3 SV=1 1 132 5.0E-14
sp|B0Y0Y6|CLP1_ASPFC mRNA cleavage and polyadenylation factor clp1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=clp1 PE=3 SV=1 1 132 5.0E-14
sp|Q7K284|CLP1_DROME Protein CLP1 homolog OS=Drosophila melanogaster GN=cbc PE=2 SV=1 1 199 7.0E-14
sp|B4QEE3|CLP1_DROSI Protein CLP1 homolog OS=Drosophila simulans GN=cbc PE=3 SV=1 1 199 7.0E-14
sp|Q28ZT4|CLP1_DROPS Protein CLP1 homolog OS=Drosophila pseudoobscura pseudoobscura GN=cbc PE=3 SV=1 1 199 8.0E-14
sp|B4GGT6|CLP1_DROPE Protein CLP1 homolog OS=Drosophila persimilis GN=cbc PE=3 SV=1 1 199 8.0E-14
sp|B4MRZ9|CLP1_DROWI Protein CLP1 homolog OS=Drosophila willistoni GN=cbc PE=3 SV=1 1 199 1.0E-13
sp|B4JVN0|CLP1_DROGR Protein CLP1 homolog OS=Drosophila grimshawi GN=cbc PE=3 SV=1 1 199 2.0E-13
sp|B3NRK6|CLP1_DROER Protein CLP1 homolog OS=Drosophila erecta GN=cbc PE=3 SV=1 1 199 5.0E-13
sp|B4MCL6|CLP1_DROVI Protein CLP1 homolog OS=Drosophila virilis GN=cbc PE=3 SV=1 1 199 5.0E-13
sp|B0VZR4|CLP1_CULQU Protein CLP1 homolog OS=Culex quinquefasciatus GN=cbc PE=3 SV=1 1 199 6.0E-13
sp|Q2UEA6|CLP1_ASPOR mRNA cleavage and polyadenylation factor clp1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=clp1 PE=3 SV=1 152 223 1.0E-12
sp|A7RG82|CLP1_NEMVE Protein CLP1 homolog OS=Nematostella vectensis GN=v1g236308 PE=3 SV=1 1 209 1.0E-12
sp|Q5ZJL4|CLP1_CHICK Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Gallus gallus GN=CLP1 PE=2 SV=2 1 199 1.0E-12
sp|Q9FLE2|CLP5_ARATH Protein CLP1 homolog 5 OS=Arabidopsis thaliana GN=CLPS5 PE=1 SV=1 1 212 2.0E-12
sp|Q4R7R3|CLP1_MACFA Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Macaca fascicularis GN=CLP1 PE=2 SV=1 1 209 6.0E-12
sp|Q92989|CLP1_HUMAN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Homo sapiens GN=CLP1 PE=1 SV=1 1 209 6.0E-12
sp|A2VE01|CLP1_BOVIN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Bos taurus GN=CLP1 PE=2 SV=1 1 209 6.0E-12
sp|A8PB32|CLP1_BRUMA Protein CLP1 homolog OS=Brugia malayi GN=Bm1_20975 PE=3 SV=1 1 213 1.0E-11
sp|B3MGZ0|CLP1_DROAN Protein CLP1 homolog OS=Drosophila ananassae GN=cbc PE=3 SV=1 1 199 1.0E-11
sp|Q6NS21|CLP1_XENLA Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Xenopus laevis GN=clp1 PE=2 SV=1 34 199 2.0E-11
sp|Q5PQL4|CLP1_RAT Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Rattus norvegicus GN=Clp1 PE=2 SV=1 34 209 2.0E-11
sp|Q99LI9|CLP1_MOUSE Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Mus musculus GN=Clp1 PE=1 SV=1 34 209 2.0E-11
sp|A8X9U4|CLP1_CAEBR Protein clpf-1 OS=Caenorhabditis briggsae GN=clpf-1 PE=3 SV=2 1 199 6.0E-11
sp|P52874|CLP1_CAEEL Protein clpf-1 OS=Caenorhabditis elegans GN=clpf-1 PE=1 SV=2 34 199 2.0E-10
sp|E7F3I6|CLP1_DANRE Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Danio rerio GN=clp1 PE=1 SV=1 1 199 4.0E-10
sp|Q66JK4|CLP1_XENTR Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Xenopus tropicalis GN=clp1 PE=2 SV=1 34 199 3.0E-09
sp|B0CS49|CLP1_LACBS mRNA cleavage and polyadenylation factor CLP1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=CLP1 PE=3 SV=1 1 214 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0031124 mRNA 3'-end processing Yes
GO:0046483 heterocycle metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0006397 mRNA processing No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No
GO:0016070 RNA metabolic process No
GO:0008152 metabolic process No
GO:0006396 RNA processing No
GO:0043170 macromolecule metabolic process No
GO:0044237 cellular metabolic process No
GO:0016071 mRNA metabolic process No
GO:0008150 biological_process No
GO:0031123 RNA 3'-end processing No
GO:0006725 cellular aromatic compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0009987 cellular process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6291
LAGAVSERLGQDAAVRAAGIVVDGMRVSEKSKVGLDLIAHVVDEFSVNVVVVLGSTRMNAELSKRFAGEKTTLGE
PIHVVSLDRSEGVVERDDNFLEHSREQIIKEYFFGDAHQPLSPQIQQVDFDSLVIYRAAEYLSPDRGDGLVREEP
NSLMQHWALAVMHASTKDAPEAVRAASVMGFVYVSDVDEERRKIKLLAPVGGRLGDRPLIWGKWPEPFINLLG*
Coding >Hirsu2|6291
CTGGCCGGCGCCGTCAGCGAGCGCCTCGGCCAGGACGCCGCCGTGCGCGCCGCCGGCATCGTCGTCGACGGCATG
CGCGTCAGCGAGAAGAGCAAGGTCGGCCTCGACCTCATCGCCCACGTCGTCGACGAGTTCTCCGTCAACGTCGTC
GTCGTCCTCGGCTCGACCCGCATGAACGCCGAGCTGTCGAAGCGCTTCGCCGGCGAGAAGACGACGCTCGGCGAG
CCCATCCACGTCGTCTCCCTCGACCGCTCCGAGGGCGTCGTCGAGCGCGACGACAACTTCCTCGAGCACTCGCGC
GAGCAGATCATCAAGGAATACTTCTTCGGCGACGCCCACCAGCCGCTGAGCCCGCAGATCCAGCAGGTCGACTTC
GACAGCCTCGTCATCTACAGGGCGGCCGAATACCTCTCGCCCGACCGGGGCGACGGCCTGGTCCGCGAGGAGCCC
AACTCGCTCATGCAGCACTGGGCCCTGGCCGTCATGCACGCGTCCACCAAGGACGCGCCCGAGGCGGTGCGCGCC
GCCTCCGTCATGGGCTTCGTCTACGTCTCCGACGTGGACGAGGAGCGCCGCAAGATCAAGCTCCTGGCCCCCGTG
GGGGGGCGCCTGGGCGACAGGCCGCTGATCTGGGGCAAGTGGCCGGAGCCCTTCATCAACCTGCTGGGCTAG
Transcript >Hirsu2|6291
CTGGCCGGCGCCGTCAGCGAGCGCCTCGGCCAGGACGCCGCCGTGCGCGCCGCCGGCATCGTCGTCGACGGCATG
CGCGTCAGCGAGAAGAGCAAGGTCGGCCTCGACCTCATCGCCCACGTCGTCGACGAGTTCTCCGTCAACGTCGTC
GTCGTCCTCGGCTCGACCCGCATGAACGCCGAGCTGTCGAAGCGCTTCGCCGGCGAGAAGACGACGCTCGGCGAG
CCCATCCACGTCGTCTCCCTCGACCGCTCCGAGGGCGTCGTCGAGCGCGACGACAACTTCCTCGAGCACTCGCGC
GAGCAGATCATCAAGGAATACTTCTTCGGCGACGCCCACCAGCCGCTGAGCCCGCAGATCCAGCAGGTCGACTTC
GACAGCCTCGTCATCTACAGGGCGGCCGAATACCTCTCGCCCGACCGGGGCGACGGCCTGGTCCGCGAGGAGCCC
AACTCGCTCATGCAGCACTGGGCCCTGGCCGTCATGCACGCGTCCACCAAGGACGCGCCCGAGGCGGTGCGCGCC
GCCTCCGTCATGGGCTTCGTCTACGTCTCCGACGTGGACGAGGAGCGCCGCAAGATCAAGCTCCTGGCCCCCGTG
GGGGGGCGCCTGGGCGACAGGCCGCTGATCTGGGGCAAGTGGCCGGAGCCCTTCATCAACCTGCTGGGCTAG
Gene >Hirsu2|6291
CTGGCCGGCGCCGTCAGCGAGCGCCTCGGCCAGGACGCCGCCGTGCGCGCCGCCGGCATCGTCGTCGACGGCATG
CGCGTCAGCGAGAAGAGCAAGGTCGGCCTCGACCTCATCGCCCACGTCGTCGACGAGTTCTCCGGTAGCCCCTCC
CCGACTCTCCCGACTCTTCCCGCGGAAGAGACAAAAAATGGAGCCAGGCCGCTGAGTTGACCGAGGAGCACAGTC
AACGTCGTCGTCGTCCTCGGCTCGACCCGCATGAACGCCGAGCTGTCGAAGCGCTTCGCCGGCGAGAAGACGACG
CTCGGCGAGCCCATCCACGTCGTCTCCCTCGACCGCTCCGAGGGCGTCGTCGAGCGCGACGACAACTTCCTCGAG
CACTCGCGCGAGCAGATCATCAAGGAATACTTCTTCGGCGACGCCCACCAGCCGCTGAGCCCGCAGATCCAGCAG
GTCGACTTCGACAGCCTCGTCATCTACAGGGCGGCCGAATGTGCGTCGTCGGCAGTGCCCCTCTTCCCCGTCCTC
CTCCTCTGTCCCCCCCCCCCCCCCTTCGCTTCTTGACCAAGCGGTGCGCTGACCCGCCGCGCCTCGGCTTCCGTG
CAGACCTCTCGCCCGACCGGGGCGACGGCCTGGTCCGCGAGGAGCCCAACTCGCTCATGCAGCACTGGGCCCTGG
CCGTCATGCACGCGTCCACCAAGGACGCGCCCGAGGCGGTGCGCGCCGCCTCCGTCATGGGCTTCGTCTACGTCT
CCGACGTGGACGAGGAGCGCCGCAAGATCAAGCTCCTGGCCCCCGTGGGGGGGCGCCTGGGCGACAGGCCGCTGA
TCTGGGGCAAGTGGCCGGAGCCCTTCATCAACCTGCTGGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail