Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|629
Gene name
LocationContig_1126:43..3632
Strand-
Gene length (bp)3589
Transcript length (bp)3465
Coding sequence length (bp)3465
Protein length (aa) 1155

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2_N SNF2 family N-terminal domain 3.8E-42 885 1152
PF04851 ResIII Type III restriction enzyme, res subunit 8.8E-05 867 1053

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 842 1152 3.0E-49
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 842 1152 2.0E-48
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 842 1152 2.0E-48
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 842 1152 2.0E-48
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 792 1151 2.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 842 1152 3.0E-49
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 842 1152 2.0E-48
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 842 1152 2.0E-48
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 842 1152 2.0E-48
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 792 1151 2.0E-42
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 842 1152 4.0E-42
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 843 1151 4.0E-37
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 842 1151 1.0E-32
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 842 1151 3.0E-32
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 867 1151 4.0E-31
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 867 1151 1.0E-30
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 867 1151 3.0E-30
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 855 1152 6.0E-30
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 867 1151 9.0E-30
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 857 1152 1.0E-29
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 854 1151 2.0E-29
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 867 1151 3.0E-29
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 867 1151 3.0E-29
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 854 1151 4.0E-29
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 867 1151 4.0E-29
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 867 1151 7.0E-29
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 798 1152 2.0E-28
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 854 1151 4.0E-28
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 865 1152 2.0E-27
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 857 1147 3.0E-27
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 857 1147 3.0E-27
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 857 1147 4.0E-27
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 857 1147 5.0E-27
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 857 1147 6.0E-27
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 864 1152 1.0E-26
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 864 1152 5.0E-26
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 851 1152 1.0E-25
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 867 1152 2.0E-25
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 867 1152 6.0E-25
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 864 1152 7.0E-25
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 857 1152 1.0E-24
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 856 1122 1.0E-23
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 867 1152 3.0E-23
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 857 1152 4.0E-23
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 866 1152 5.0E-23
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 857 1152 9.0E-23
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 853 1152 2.0E-22
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 862 1122 6.0E-22
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 867 1151 8.0E-22
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 870 1152 1.0E-21
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 891 1151 1.0E-21
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 866 1152 2.0E-21
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 754 1151 2.0E-21
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 829 1151 3.0E-21
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 754 1151 3.0E-21
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 870 1152 3.0E-21
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 850 1153 5.0E-21
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 865 1151 6.0E-21
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 857 1122 6.0E-21
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 846 1152 1.0E-20
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 862 1122 1.0E-20
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 850 1152 4.0E-20
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 867 1134 7.0E-20
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 864 1151 1.0E-19
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 866 1152 2.0E-19
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 839 1152 3.0E-19
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 864 1151 4.0E-19
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 867 1073 5.0E-19
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 854 1152 1.0E-18
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 858 1152 1.0E-18
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 853 1151 2.0E-18
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 866 1152 2.0E-18
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 863 1152 2.0E-18
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 862 1152 4.0E-18
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 819 1152 5.0E-18
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 864 1152 5.0E-18
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 864 1152 9.0E-18
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 867 1134 1.0E-17
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 863 1152 1.0E-17
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 867 1152 1.0E-17
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 867 1152 3.0E-17
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 866 1152 3.0E-17
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 849 1153 3.0E-17
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 810 1152 4.0E-17
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 849 1153 4.0E-17
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 866 1152 5.0E-17
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 865 1152 5.0E-17
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 893 1151 7.0E-17
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 870 1152 9.0E-17
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 866 1152 1.0E-16
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 893 1151 1.0E-16
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 866 1152 1.0E-16
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 866 1152 1.0E-16
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 893 1151 1.0E-16
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 863 1152 1.0E-16
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 867 1151 1.0E-16
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 864 1152 2.0E-16
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 891 1154 2.0E-16
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 867 1152 2.0E-16
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 864 1152 3.0E-16
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 867 1152 3.0E-16
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 893 1134 3.0E-16
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 850 1152 3.0E-16
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 893 1151 3.0E-16
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 849 1153 4.0E-16
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 858 1152 4.0E-16
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 858 1152 4.0E-16
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 867 1152 5.0E-16
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 850 1152 5.0E-16
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 867 1152 5.0E-16
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 867 1152 5.0E-16
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 867 1152 5.0E-16
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 862 1152 6.0E-16
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 864 1152 7.0E-16
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 849 1152 9.0E-16
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 867 1151 1.0E-15
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 867 1152 1.0E-15
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 867 1152 2.0E-15
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 893 1151 2.0E-15
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 858 1152 2.0E-15
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 893 1151 2.0E-15
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 850 1152 3.0E-15
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 863 1152 4.0E-15
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 863 1152 4.0E-15
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 864 1151 5.0E-15
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 880 1151 9.0E-15
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 862 1152 9.0E-15
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 867 1152 1.0E-14
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 862 1152 1.0E-14
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 866 1152 1.0E-14
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 866 1153 1.0E-14
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 862 1152 1.0E-14
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 855 1151 1.0E-14
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 866 1152 1.0E-14
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 866 1152 1.0E-14
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 799 1152 2.0E-14
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 852 1151 2.0E-14
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 870 1152 2.0E-14
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 863 1152 2.0E-14
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 858 1152 3.0E-14
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 855 1151 3.0E-14
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 864 1152 3.0E-14
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 867 1152 4.0E-14
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 893 1151 4.0E-14
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 867 1153 4.0E-14
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 799 1152 5.0E-14
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 846 1150 7.0E-14
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 870 1151 8.0E-14
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 855 1151 1.0E-13
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 880 1152 1.0E-13
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 850 1139 1.0E-13
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 867 1152 1.0E-13
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 853 1147 1.0E-13
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 893 1151 2.0E-13
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 867 1152 3.0E-13
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 893 1151 4.0E-13
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 867 1152 4.0E-13
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 867 1153 5.0E-13
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 867 1153 9.0E-13
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 866 1151 9.0E-13
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 855 1070 9.0E-13
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 867 1152 9.0E-13
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 866 1151 1.0E-12
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 866 1151 2.0E-12
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 893 1152 2.0E-12
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 867 1153 2.0E-12
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 867 1151 3.0E-12
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 863 1151 3.0E-12
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 866 1151 3.0E-12
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 866 1088 4.0E-12
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 867 1134 4.0E-12
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 866 1152 6.0E-12
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 893 1151 6.0E-12
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 846 1149 8.0E-12
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 866 1088 8.0E-12
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 867 1153 9.0E-12
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 867 1073 9.0E-12
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 867 1153 9.0E-12
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 866 1088 1.0E-11
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 866 1088 1.0E-11
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 867 1153 1.0E-11
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 893 1151 1.0E-11
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 866 1088 1.0E-11
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 866 1088 1.0E-11
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 866 1088 1.0E-11
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 887 1151 2.0E-11
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 866 1152 2.0E-11
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 866 1152 2.0E-11
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 866 1088 2.0E-11
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 893 1151 2.0E-11
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 866 1152 2.0E-11
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 866 1071 3.0E-11
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 867 1151 3.0E-11
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 882 1149 4.0E-11
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 882 1149 5.0E-11
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 866 1088 7.0E-11
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 867 1151 8.0E-11
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 867 1151 9.0E-11
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 867 1152 1.0E-10
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 864 1152 2.0E-10
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 829 1151 2.0E-10
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 870 1068 2.0E-10
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 890 1090 3.0E-10
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 866 1088 4.0E-10
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 865 1073 6.0E-10
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 813 1073 6.0E-10
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 870 1150 7.0E-10
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 893 1151 9.0E-10
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 893 1151 9.0E-10
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 890 1079 1.0E-09
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 889 1122 1.0E-09
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 852 1122 2.0E-09
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 808 1151 2.0E-09
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 893 1151 3.0E-09
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 872 1122 3.0E-09
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 852 1152 4.0E-09
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 838 1151 3.0E-08
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 937 1153 4.0E-08
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 937 1153 5.0E-08
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 871 1071 2.0E-07
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 933 1152 1.0E-06
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 887 1151 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0030554 adenyl nucleotide binding No
GO:0003674 molecular_function No
GO:0008144 drug binding No
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0043168 anion binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|629
MEGIRYDDPFLWDEETVAENLCSLERPCTRDPAALSSRIKEEGMDGQNLLTFDFVCSRPELFESLGIKVGGHKAS
LARAIVGFRSRSSAFRQWKLEFLNELSGDATASISDSFLPNHSARPAQAADLKAPDTGEERPAWTSVPDAPKRKV
EALENPSLSTHDTKPQTSPPVFVQTTPTPGGDAKAHGPTAEEPAKRKRIAPLQISTEPVIDQSRAFALEADPVLR
RAMKEEAMMEETMVEGDRPQQQDTFPWENEPAQAYLGDGFLSVTAIKSPDQRVSTQLREDSRSFTTRPLPNRLPV
GLRLSVNHTMRQVLAKNSRLEASLRRGIVPMRSLTPTEDDDEVLELFDLPDTLDDDTLREVEAEKEELARAREAK
AFVDEARVNTLLLEAAADFKTRWEERKLPKHQRKAHKLWTDATRRGIKTQRIIAARQCAKDYDRRIQKIVAEILG
QTWTKESDIRKQARSFEQSVEDKLYSLWLADMLESRIEPPKPDSMPRLRRPAAATRSQSYSDGEVLTSSDEDDFV
VADDEDEMQTDGPDPVPRSRATTPFGPSPIKPESPLFVDLTQVETPESMRRHRRHMSPIDLTTPSKLRGRVSYSS
LPRDGDDSGLHPAEEADSTNDTFESFEVIGKQPPSHWTKLGDRSRLLICLLWRLPHARRGRIFEAVRNTSGRDLY
EQSVKRQLSDPLEDFAQLDQGGPSVMAFDVTRLFLSYVSVKGIRLKRVFRLSAANKKRLNDAQGAPWHDFCAFVK
RVAPDFPEDSQILRGDAFDAELAELDDIDDDVPPDSQDTPCKRKNAVKEIVQNKEAVDIREREKRRVEEQEARRL
KLRAALDTSGSMPRDKSRLIINEAKQEDQPFIYVNEETGKRIKDHQIEGVRFIWNQVVLDEDARQGCLLAHTMGL
GKTMQVITFLVAIQESVASPDPAVRSQIPEDLRQSKTLILCPAGLVDNWMDELLLWAPEGLLGPIRKIESLQAPE
VRKMNVDDWARGGGVLVTGYNMLQKVVAGDDEVEAQLIAGPNIVVADEAHVLKNPEARVHQVCARFETKCRIALT
GSPLANNVEEYYSMINWVAPNYLGPLGEFKEIYARPIQQGLWGDSERYEKRKALKILQVLKTTVAPKVNRATVNS
CLKRDLPPKHEFVISVPPTALQQKLYQLR*
Coding >Hirsu2|629
ATGGAAGGAATCCGTTACGACGACCCGTTCCTTTGGGACGAGGAGACCGTCGCCGAGAATTTGTGTTCCTTGGAG
CGGCCGTGCACGCGCGATCCGGCCGCCCTCTCAAGCAGGATCAAGGAGGAGGGCATGGATGGCCAGAACCTCTTG
ACATTTGACTTCGTCTGCTCGAGACCGGAGCTCTTCGAGTCTCTGGGCATCAAAGTTGGCGGCCACAAGGCCTCG
CTGGCGCGCGCCATTGTCGGCTTCCGCTCCAGGAGCTCTGCCTTTCGTCAGTGGAAGCTCGAATTCCTCAACGAG
CTGTCTGGTGATGCGACGGCCTCCATCTCCGACTCGTTTTTGCCAAACCACTCAGCACGGCCCGCGCAGGCTGCC
GATCTGAAGGCTCCTGATACTGGCGAGGAGCGACCGGCATGGACATCGGTACCTGACGCACCGAAACGCAAGGTC
GAAGCGCTTGAGAATCCGTCGCTCTCTACCCATGACACAAAGCCTCAAACGTCTCCCCCAGTCTTCGTCCAAACC
ACGCCAACACCCGGCGGTGATGCGAAGGCCCATGGCCCTACGGCGGAAGAGCCCGCAAAGCGGAAGCGAATTGCA
CCCCTACAGATCTCAACCGAGCCCGTCATTGACCAGTCACGCGCTTTCGCCCTCGAGGCAGACCCCGTGCTGCGC
CGGGCCATGAAGGAAGAGGCCATGATGGAAGAGACCATGGTAGAAGGGGATCGACCACAGCAGCAAGACACTTTT
CCCTGGGAAAATGAGCCCGCACAAGCGTACCTTGGCGACGGATTCCTATCTGTAACTGCCATCAAGTCACCCGAT
CAGCGCGTTTCCACGCAGCTGCGAGAGGACAGCCGCTCCTTCACCACCAGGCCTCTTCCCAACAGACTTCCCGTC
GGCTTGCGACTCTCGGTCAATCACACCATGCGCCAGGTGCTGGCTAAGAATAGCCGCCTCGAGGCTTCGCTGCGT
CGAGGCATTGTGCCTATGCGGTCGCTCACGCCAACGGAGGATGACGATGAAGTCCTCGAGCTGTTCGACCTTCCT
GACACCTTGGACGACGACACATTGCGCGAAGTTGAAGCCGAGAAGGAAGAGCTTGCCAGAGCGCGAGAGGCGAAA
GCGTTCGTGGACGAAGCGCGAGTAAACACCTTACTGCTGGAGGCCGCAGCCGACTTCAAGACGAGATGGGAAGAG
AGGAAGCTCCCGAAACATCAACGCAAGGCCCACAAGTTGTGGACAGACGCGACAAGACGGGGCATCAAGACTCAA
CGGATAATCGCGGCTCGGCAGTGCGCAAAGGACTACGACCGCCGGATCCAGAAGATCGTGGCTGAGATCCTGGGG
CAGACGTGGACCAAGGAATCTGACATTCGGAAACAGGCTAGGAGCTTCGAGCAGAGCGTGGAGGACAAGCTCTAC
AGCCTGTGGCTTGCGGACATGTTGGAGTCCCGCATCGAGCCGCCGAAGCCGGACAGCATGCCGAGACTTAGGCGC
CCGGCGGCCGCGACGAGGTCGCAGAGCTATTCTGACGGCGAGGTGCTGACGAGCTCGGACGAGGATGATTTCGTC
GTCGCCGACGACGAGGACGAAATGCAGACCGATGGTCCCGACCCCGTTCCCAGATCCCGCGCCACGACTCCGTTC
GGGCCAAGTCCGATAAAGCCAGAGTCTCCCCTGTTCGTGGACCTCACACAGGTTGAAACGCCGGAGAGCATGCGG
CGTCACCGCCGACACATGTCGCCCATCGACTTGACGACTCCGAGTAAACTGAGGGGCCGTGTCTCGTACTCTTCT
CTGCCGCGCGACGGCGACGACTCTGGCCTACATCCTGCCGAAGAGGCAGACTCCACCAATGACACCTTCGAGAGC
TTCGAAGTTATCGGAAAGCAGCCCCCCAGCCACTGGACTAAGCTTGGAGATCGCTCGAGACTGCTGATCTGCCTC
TTGTGGCGGCTCCCACACGCTCGCCGCGGCCGCATCTTCGAGGCCGTCCGCAATACGTCCGGCAGGGACTTGTAT
GAGCAGTCGGTGAAAAGACAGCTGTCCGATCCGCTCGAGGACTTTGCTCAGCTCGACCAGGGAGGGCCTTCGGTG
ATGGCCTTCGATGTGACGCGGCTGTTCCTGAGCTACGTCAGTGTGAAAGGCATCAGACTGAAGCGCGTCTTCAGA
CTGTCTGCCGCCAACAAGAAGCGGCTCAACGATGCGCAGGGAGCGCCCTGGCACGACTTTTGCGCCTTCGTCAAA
CGGGTCGCGCCAGACTTTCCAGAGGACAGTCAGATCCTCAGAGGGGACGCGTTCGACGCCGAACTGGCCGAACTC
GACGACATCGATGATGACGTCCCTCCCGATTCTCAAGACACCCCCTGCAAGCGCAAAAATGCGGTCAAGGAGATC
GTCCAGAACAAGGAAGCGGTGGACATCCGCGAGAGGGAGAAGCGCCGTGTCGAAGAGCAGGAAGCCCGACGCCTC
AAGCTAAGAGCTGCCCTGGACACGTCCGGCTCCATGCCCCGAGACAAGTCGAGACTCATCATTAACGAGGCAAAG
CAGGAGGACCAACCGTTCATATACGTCAACGAGGAGACGGGCAAGCGGATCAAGGACCATCAGATCGAGGGCGTG
CGCTTCATATGGAACCAGGTCGTCCTCGACGAGGACGCACGCCAAGGCTGCCTGCTGGCGCACACCATGGGCTTG
GGGAAGACCATGCAGGTCATCACGTTTCTTGTGGCTATACAGGAGTCGGTCGCGTCGCCCGACCCGGCCGTGAGG
AGCCAGATACCGGAGGACCTCAGACAGTCGAAGACACTGATCCTGTGCCCCGCCGGCCTGGTCGACAACTGGATG
GACGAGCTCCTCCTCTGGGCCCCGGAGGGCCTGCTCGGTCCCATCCGCAAGATCGAGTCGCTCCAGGCGCCGGAG
GTACGGAAGATGAATGTCGACGACTGGGCGCGGGGAGGTGGCGTCCTGGTCACCGGATACAACATGCTGCAAAAG
GTGGTGGCCGGCGACGACGAGGTTGAGGCTCAGCTGATCGCGGGGCCCAACATCGTCGTTGCGGACGAGGCCCAC
GTCCTCAAGAACCCGGAAGCCAGGGTCCACCAGGTCTGCGCGCGCTTCGAGACTAAGTGTCGGATCGCGCTGACG
GGCTCACCGCTGGCAAACAACGTGGAGGAGTACTACTCCATGATCAACTGGGTCGCGCCCAACTATCTCGGCCCG
CTCGGCGAGTTCAAGGAGATCTACGCGCGCCCCATCCAGCAGGGGCTGTGGGGGGACAGTGAGAGGTATGAAAAG
CGCAAGGCGCTGAAGATTCTGCAGGTGCTCAAGACGACGGTGGCGCCCAAGGTCAACCGGGCGACGGTCAACTCG
TGTCTGAAGAGGGACCTGCCGCCCAAGCACGAGTTCGTCATCTCGGTCCCGCCGACGGCCCTGCAGCAGAAGCTG
TACCAGTTAAGGTGA
Transcript >Hirsu2|629
ATGGAAGGAATCCGTTACGACGACCCGTTCCTTTGGGACGAGGAGACCGTCGCCGAGAATTTGTGTTCCTTGGAG
CGGCCGTGCACGCGCGATCCGGCCGCCCTCTCAAGCAGGATCAAGGAGGAGGGCATGGATGGCCAGAACCTCTTG
ACATTTGACTTCGTCTGCTCGAGACCGGAGCTCTTCGAGTCTCTGGGCATCAAAGTTGGCGGCCACAAGGCCTCG
CTGGCGCGCGCCATTGTCGGCTTCCGCTCCAGGAGCTCTGCCTTTCGTCAGTGGAAGCTCGAATTCCTCAACGAG
CTGTCTGGTGATGCGACGGCCTCCATCTCCGACTCGTTTTTGCCAAACCACTCAGCACGGCCCGCGCAGGCTGCC
GATCTGAAGGCTCCTGATACTGGCGAGGAGCGACCGGCATGGACATCGGTACCTGACGCACCGAAACGCAAGGTC
GAAGCGCTTGAGAATCCGTCGCTCTCTACCCATGACACAAAGCCTCAAACGTCTCCCCCAGTCTTCGTCCAAACC
ACGCCAACACCCGGCGGTGATGCGAAGGCCCATGGCCCTACGGCGGAAGAGCCCGCAAAGCGGAAGCGAATTGCA
CCCCTACAGATCTCAACCGAGCCCGTCATTGACCAGTCACGCGCTTTCGCCCTCGAGGCAGACCCCGTGCTGCGC
CGGGCCATGAAGGAAGAGGCCATGATGGAAGAGACCATGGTAGAAGGGGATCGACCACAGCAGCAAGACACTTTT
CCCTGGGAAAATGAGCCCGCACAAGCGTACCTTGGCGACGGATTCCTATCTGTAACTGCCATCAAGTCACCCGAT
CAGCGCGTTTCCACGCAGCTGCGAGAGGACAGCCGCTCCTTCACCACCAGGCCTCTTCCCAACAGACTTCCCGTC
GGCTTGCGACTCTCGGTCAATCACACCATGCGCCAGGTGCTGGCTAAGAATAGCCGCCTCGAGGCTTCGCTGCGT
CGAGGCATTGTGCCTATGCGGTCGCTCACGCCAACGGAGGATGACGATGAAGTCCTCGAGCTGTTCGACCTTCCT
GACACCTTGGACGACGACACATTGCGCGAAGTTGAAGCCGAGAAGGAAGAGCTTGCCAGAGCGCGAGAGGCGAAA
GCGTTCGTGGACGAAGCGCGAGTAAACACCTTACTGCTGGAGGCCGCAGCCGACTTCAAGACGAGATGGGAAGAG
AGGAAGCTCCCGAAACATCAACGCAAGGCCCACAAGTTGTGGACAGACGCGACAAGACGGGGCATCAAGACTCAA
CGGATAATCGCGGCTCGGCAGTGCGCAAAGGACTACGACCGCCGGATCCAGAAGATCGTGGCTGAGATCCTGGGG
CAGACGTGGACCAAGGAATCTGACATTCGGAAACAGGCTAGGAGCTTCGAGCAGAGCGTGGAGGACAAGCTCTAC
AGCCTGTGGCTTGCGGACATGTTGGAGTCCCGCATCGAGCCGCCGAAGCCGGACAGCATGCCGAGACTTAGGCGC
CCGGCGGCCGCGACGAGGTCGCAGAGCTATTCTGACGGCGAGGTGCTGACGAGCTCGGACGAGGATGATTTCGTC
GTCGCCGACGACGAGGACGAAATGCAGACCGATGGTCCCGACCCCGTTCCCAGATCCCGCGCCACGACTCCGTTC
GGGCCAAGTCCGATAAAGCCAGAGTCTCCCCTGTTCGTGGACCTCACACAGGTTGAAACGCCGGAGAGCATGCGG
CGTCACCGCCGACACATGTCGCCCATCGACTTGACGACTCCGAGTAAACTGAGGGGCCGTGTCTCGTACTCTTCT
CTGCCGCGCGACGGCGACGACTCTGGCCTACATCCTGCCGAAGAGGCAGACTCCACCAATGACACCTTCGAGAGC
TTCGAAGTTATCGGAAAGCAGCCCCCCAGCCACTGGACTAAGCTTGGAGATCGCTCGAGACTGCTGATCTGCCTC
TTGTGGCGGCTCCCACACGCTCGCCGCGGCCGCATCTTCGAGGCCGTCCGCAATACGTCCGGCAGGGACTTGTAT
GAGCAGTCGGTGAAAAGACAGCTGTCCGATCCGCTCGAGGACTTTGCTCAGCTCGACCAGGGAGGGCCTTCGGTG
ATGGCCTTCGATGTGACGCGGCTGTTCCTGAGCTACGTCAGTGTGAAAGGCATCAGACTGAAGCGCGTCTTCAGA
CTGTCTGCCGCCAACAAGAAGCGGCTCAACGATGCGCAGGGAGCGCCCTGGCACGACTTTTGCGCCTTCGTCAAA
CGGGTCGCGCCAGACTTTCCAGAGGACAGTCAGATCCTCAGAGGGGACGCGTTCGACGCCGAACTGGCCGAACTC
GACGACATCGATGATGACGTCCCTCCCGATTCTCAAGACACCCCCTGCAAGCGCAAAAATGCGGTCAAGGAGATC
GTCCAGAACAAGGAAGCGGTGGACATCCGCGAGAGGGAGAAGCGCCGTGTCGAAGAGCAGGAAGCCCGACGCCTC
AAGCTAAGAGCTGCCCTGGACACGTCCGGCTCCATGCCCCGAGACAAGTCGAGACTCATCATTAACGAGGCAAAG
CAGGAGGACCAACCGTTCATATACGTCAACGAGGAGACGGGCAAGCGGATCAAGGACCATCAGATCGAGGGCGTG
CGCTTCATATGGAACCAGGTCGTCCTCGACGAGGACGCACGCCAAGGCTGCCTGCTGGCGCACACCATGGGCTTG
GGGAAGACCATGCAGGTCATCACGTTTCTTGTGGCTATACAGGAGTCGGTCGCGTCGCCCGACCCGGCCGTGAGG
AGCCAGATACCGGAGGACCTCAGACAGTCGAAGACACTGATCCTGTGCCCCGCCGGCCTGGTCGACAACTGGATG
GACGAGCTCCTCCTCTGGGCCCCGGAGGGCCTGCTCGGTCCCATCCGCAAGATCGAGTCGCTCCAGGCGCCGGAG
GTACGGAAGATGAATGTCGACGACTGGGCGCGGGGAGGTGGCGTCCTGGTCACCGGATACAACATGCTGCAAAAG
GTGGTGGCCGGCGACGACGAGGTTGAGGCTCAGCTGATCGCGGGGCCCAACATCGTCGTTGCGGACGAGGCCCAC
GTCCTCAAGAACCCGGAAGCCAGGGTCCACCAGGTCTGCGCGCGCTTCGAGACTAAGTGTCGGATCGCGCTGACG
GGCTCACCGCTGGCAAACAACGTGGAGGAGTACTACTCCATGATCAACTGGGTCGCGCCCAACTATCTCGGCCCG
CTCGGCGAGTTCAAGGAGATCTACGCGCGCCCCATCCAGCAGGGGCTGTGGGGGGACAGTGAGAGGTATGAAAAG
CGCAAGGCGCTGAAGATTCTGCAGGTGCTCAAGACGACGGTGGCGCCCAAGGTCAACCGGGCGACGGTCAACTCG
TGTCTGAAGAGGGACCTGCCGCCCAAGCACGAGTTCGTCATCTCGGTCCCGCCGACGGCCCTGCAGCAGAAGCTG
TACCAGTTAAGGTGA
Gene >Hirsu2|629
ATGGAAGGAATCCGTTACGACGACCCGTTCCTTTGGGACGAGGAGACCGTCGCCGAGAATTTGTGTTCCTTGGAG
CGGCCGTGCACGCGCGATCCGGCCGCCCTCTCAAGCAGGATCAAGGAGGAGGGCATGGATGGCCAGAACCTCTTG
ACATTTGACTTCGTCTGCTCGAGACCGGAGCTCTTCGAGTCTCTGGGCATCAAAGTTGGCGGCCACAAGGCCTCG
CTGGCGCGCGCCATTGTCGGCTTCCGCTCCAGGAGCTCTGCCTTTCGTCAGTGGAAGCTCGAATTCCTCAACGAG
CTGTCTGGTGATGCGACGGCCTCCATCTCCGACTCGTTTTTGCCAAACCACTCAGCACGGCCCGCGCAGGCTGCC
GATCTGAAGGCTCCTGATACTGGCGAGGAGCGACCGGCATGGACATCGGTACCTGACGCACCGAAACGCAAGGTC
GAAGCGCTTGAGAATCCGTCGCTCTCTACCCATGACACAAAGCCTCAAACGTCTCCCCCAGTCTTCGTCCAAACC
ACGCCAACACCCGGCGGTGATGCGAAGGCCCATGGCCCTACGGCGGAAGAGCCCGCAAAGCGGAAGCGAATTGCA
CCCCTACAGATCTCAACCGAGCCCGTCATTGACCAGTCACGCGCTTTCGCCCTCGAGGCAGACCCCGTGCTGCGC
CGGGCCATGAAGGAAGAGGCCATGATGGAAGAGACCATGGTAGAAGGGGATCGACCACAGCAGCAAGACACTTTT
CCCTGGGAAAATGAGCCCGCACAAGCGTACCTTGGCGACGGATTCCTATCTGTAACTGCCATCAAGTCACCCGAT
CAGCGCGTTTCCACGCAGCTGCGAGAGGACAGCCGCTCCTTCACCACCAGGCCTCTTCCCAACAGACTTCCCGTC
GGCTTGCGACTCTCGGTCAATCACACCATGCGCCAGGTGCTGGCTAAGAATAGCCGCCTCGAGGCTTCGCTGCGT
CGAGGCATTGTGCCTATGCGGTCGCTCACGCCAACGGAGGATGACGATGAAGTCCTCGAGCTGTTCGACCTTCCT
GACACCTTGGACGACGACACATTGCGCGAAGTTGAAGCCGAGAAGGAAGAGCTTGCCAGAGCGCGAGAGGCGAAA
GCGTTCGTGGACGAAGCGCGAGTAAACACCTTACTGCTGGAGGCCGCAGCCGACTTCAAGACGAGATGGGAAGAG
AGGAAGCTCCCGAAACATCAACGCAAGGCCCACAAGTTGTGGACAGACGCGACAAGACGGGGCATCAAGACTCAA
CGGATAATCGCGGCTCGGCAGTGCGCAAAGGACTACGACCGCCGGATCCAGAAGATCGTGGCTGAGATCCTGGGG
CAGACGTGGACCAAGGAATCTGACATTCGGAAACAGGCTAGGAGCTTCGAGCAGAGCGTGGAGGACAAGCTCTAC
AGCCTGTGGCTTGCGGACATGTTGGAGTCCCGCATCGAGCCGCCGAAGCCGGACAGCATGCCGAGACTTAGGCGC
CCGGCGGCCGCGACGAGGTCGCAGAGCTATTCTGACGGCGAGGTGCTGACGAGCTCGGACGAGGATGATTTCGTC
GTCGCCGACGACGAGGACGAAATGCAGACCGATGGTCCCGACCCCGTTCCCAGATCCCGCGCCACGACTCCGTTC
GGGCCAAGTCCGATAAAGCCAGAGTCTCCCCTGTTCGTGGACCTCACACAGGTTGAAACGCCGGAGAGCATGCGG
CGTCACCGCCGACACATGTCGCCCATCGACTTGACGACTCCGAGTAAACTGAGGGGCCGTGTCTCGTACTCTTCT
CTGCCGCGCGACGGCGACGACTCTGGCCTACATCCTGCCGAAGAGGCAGACTCCACCAATGACACCTTCGAGAGC
TTCGAAGTTATCGGAAAGCAGCCCCCCAGCCACTGGACTAAGCTTGGAGATCGCTCGAGACTGCTGATCTGCCTC
TTGTGGCGGCTCCCACACGCTCGCCGCGGCCGCATCTTCGAGGCCGTCCGCAATACGTCCGGCAGGGACTTGTAT
GAGCAGTCGGTGAAAAGACAGCTGTCCGATCCGCTCGAGGACTTTGCTCAGCTCGACCAGGGAGGGCCTTCGGTG
ATGGCCTTCGATGTGACGCGGCTGTTCCTGAGCTACGTCAGTGTGAAAGGCATCAGACTGAAGCGCGTCTTCAGA
CTGTCTGCCGCCAACAAGAAGCGGCTCAACGATGCGCAGGGAGCGCCCTGGCACGACTTTTGCGCCTTCGTCAAA
CGGGTCGCGCCAGACTTTCCAGAGGACAGTCAGATCCTCAGAGGGGACGCGTTCGACGCCGAACTGGCCGAACTC
GACGACATCGATGATGACGTCCCTCCCGATTCTCAAGACACCCCCTGCAAGCGCAAAAATGCGGTCAAGGAGATC
GTCCAGAACAAGGAAGCGGTGGACATCCGCGAGAGGGAGAAGCGCCGTGTCGAAGAGCAGGAAGCCCGACGCCTC
AAGCTAAGAGCTGCCCTGGACACGTCCGGCTCCATGCCCCGAGACAAGTCGAGACTCATCATTAACGAGGCAAAG
CAGGAGGACCAACCGTTCATATACGTCAACGAGGAGACGGGCAAGCGGATCAAGGACCATCAGATCGAGGGCGTG
CGCTTCATATGGAACCAGGTCGTCCTCGACGAGGACGCACGCCAAGGCTGCCTGCTGGCGCACACCATGGGCTTG
GGGAAGACCATGCAGGTCATCACGTTTCTTGTGGCTATACAGGAGTCGGTCGCGTCGCCCGACCCGGCCGTGAGG
AGCCAGATACCGGAGGACCTCAGACAGTCGAAGACACTGATCCTGTGCCCCGCCGGCCTGGTCGACAACTGGATG
GACGAGCTCCTCCTCTGGGCCCCGGAGGGCCTGCTCGGTCCCATCCGCAAGATCGAGTCGCTCCAGGCGCCGGAG
GTACGGAAGATGAATGTCGACGACTGGGCGCGGGGAGGTGGCGTCCTGGTCACCGGATACAACATGCTGCAAAAG
GTGGTGGCCGGCGACGACGAGGTTGAGGCTCAGCTGATCGCGGGGCCCAACATCGTCGTTGCGGACGAGGCCCAC
GTCCTCAAGAACCCGGAAGCCAGGGTCCACCAGGTCTGCGCGCGCTTCGAGACTAAGTGTCGGATCGCGCTGACG
GGCTCACCGCTGGCAAACAACGTGGAGGAGTACTACTCCATGATCAACTGGGTCGCGCCCAACTATCTCGGCCCG
CTCGGCGAGTTCAAGGAGATCTACGCGCGCCCCATCCAGCAGGGGCTGTGGGGGGACAGTGAGAGGTATGAAAAG
CGCAAGGCGCTGAAGATTCTGCAGGTGCTCAAGACGACGGTGGCGCCCAAGGTCAACCGGGCGACGGTCAACTCG
TGTCTGAAGAGGGACCTGCCGCCCAAGCACGAGTTCGTCATCTCGGTCCCGCCGACGGCCCTGCAGCAGAAGCTG
TACCAGTTGTACGTCGACGGCATCCGCGGCGAAGCCACGGTAACCGGCAAGAAGAAGATGGGGCCGGGACTGCTC
TTCAACGTCGTCAGCGACCTGGGCCTGCTCTGCAACCATCCGCAGTGCTTTCGGAAGAAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail