Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6281
Gene name
LocationContig_32:35430..37209
Strand+
Gene length (bp)1779
Transcript length (bp)1584
Coding sequence length (bp)1584
Protein length (aa) 528

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 3.5E-29 36 440

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 6 504 3.0E-51
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 2 525 1.0E-34
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 11 403 3.0E-33
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 30 525 1.0E-31
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 18 519 5.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 6 504 3.0E-51
sp|Q10072|YAN6_SCHPO Uncharacterized transporter C3H1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC3H1.06c PE=3 SV=1 2 525 1.0E-34
sp|O42922|YBIH_SCHPO Uncharacterized MFS-type transporter C16A3.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.17c PE=3 SV=1 11 403 3.0E-33
sp|Q9HE13|YI32_SCHPO Uncharacterized MFS-type transporter C1399.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1399.02 PE=3 SV=1 30 525 1.0E-31
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 18 519 5.0E-30
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 2 470 7.0E-28
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 28 485 8.0E-26
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 28 485 8.0E-26
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 41 525 9.0E-26
sp|P25594|VBA3_YEAST Vacuolar basic amino acid transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA3 PE=1 SV=1 117 470 1.0E-18
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 45 483 5.0E-17
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 45 448 1.0E-16
sp|P39886|TCMA_STRGA Tetracenomycin C resistance and export protein OS=Streptomyces glaucescens GN=tcmA PE=3 SV=1 13 462 2.0E-15
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 45 342 7.0E-15
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 44 527 4.0E-14
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 15 377 2.0E-13
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 44 527 5.0E-13
sp|P46105|ACT22_STRCO Probable actinorhodin transporter OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=actII-2 PE=3 SV=1 19 511 3.0E-12
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 10 339 3.0E-12
sp|Q00538|MMR_BACSU Methylenomycin A resistance protein OS=Bacillus subtilis (strain 168) GN=mmr PE=3 SV=1 40 350 3.0E-12
sp|A4WCC3|MDTD_ENT38 Putative multidrug resistance protein MdtD OS=Enterobacter sp. (strain 638) GN=mdtD PE=3 SV=1 24 342 4.0E-12
sp|P11545|MMR_STRCO Methylenomycin A resistance protein OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=mmr PE=3 SV=1 12 350 5.0E-12
sp|C6DBD0|MDTD_PECCP Putative multidrug resistance protein MdtD OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=mdtD PE=3 SV=1 26 360 6.0E-12
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 40 338 2.0E-11
sp|B1JSD2|MDTD_YERPY Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtD PE=3 SV=1 22 360 3.0E-11
sp|A4TMR4|MDTD_YERPP Putative multidrug resistance protein MdtD OS=Yersinia pestis (strain Pestoides F) GN=mdtD PE=3 SV=1 22 360 3.0E-11
sp|Q1CK62|MDTD_YERPN Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtD PE=3 SV=1 22 360 3.0E-11
sp|A9QZU7|MDTD_YERPG Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtD PE=3 SV=1 22 360 3.0E-11
sp|Q7CJL1|MDTD_YERPE Putative multidrug resistance protein MdtD OS=Yersinia pestis GN=mdtD PE=3 SV=1 22 360 3.0E-11
sp|B2K9M2|MDTD_YERPB Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtD PE=3 SV=1 22 360 3.0E-11
sp|Q1C5L8|MDTD_YERPA Putative multidrug resistance protein MdtD OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtD PE=3 SV=1 22 360 3.0E-11
sp|A7FG15|MDTD_YERP3 Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtD PE=3 SV=1 22 360 3.0E-11
sp|Q6D2A9|MDTD_PECAS Putative multidrug resistance protein MdtD OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtD PE=3 SV=1 26 360 4.0E-11
sp|Q668C4|MDTD_YERPS Putative multidrug resistance protein MdtD OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtD PE=3 SV=1 22 360 1.0E-10
sp|A8AEE4|MDTD_CITK8 Putative multidrug resistance protein MdtD OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtD PE=3 SV=1 27 360 2.0E-10
sp|A1JKW8|MDTD_YERE8 Putative multidrug resistance protein MdtD OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtD PE=3 SV=2 40 342 2.0E-10
sp|A8GHR1|MDTD_SERP5 Putative multidrug resistance protein MdtD OS=Serratia proteamaculans (strain 568) GN=mdtD PE=3 SV=1 21 342 2.0E-10
sp|B5XPB7|MDTD_KLEP3 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae (strain 342) GN=mdtD PE=3 SV=1 26 360 3.0E-10
sp|A6TBH6|MDTD_KLEP7 Putative multidrug resistance protein MdtD OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtD PE=3 SV=1 26 360 4.0E-10
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 16 339 2.0E-09
sp|A9N7L0|MDTD_SALPB Putative multidrug resistance protein MdtD OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtD PE=3 SV=1 27 208 2.0E-09
sp|P44903|HSRA_HAEIN Probable transport protein HsrA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hsrA PE=3 SV=1 91 378 3.0E-09
sp|P42670|PUR8_STRAD Puromycin resistance protein pur8 OS=Streptomyces alboniger GN=pur8 PE=3 SV=1 6 502 3.0E-09
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 34 245 9.0E-09
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 34 245 9.0E-09
sp|P9WJY5|EFPA_MYCTU Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=efpA PE=1 SV=1 94 342 5.0E-08
sp|P9WJY4|EFPA_MYCTO Uncharacterized MFS-type transporter EfpA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=efpA PE=3 SV=1 94 342 5.0E-08
sp|P31474|HSRA_ECOLI Probable transport protein HsrA OS=Escherichia coli (strain K12) GN=hsrA PE=1 SV=1 14 194 8.0E-08
sp|O34502|YVKA_BACSU Uncharacterized MFS-type transporter YvkA OS=Bacillus subtilis (strain 168) GN=yvkA PE=3 SV=1 27 353 2.0E-07
sp|P0AEJ0|EMRB_ECOLI Multidrug export protein EmrB OS=Escherichia coli (strain K12) GN=emrB PE=1 SV=1 15 342 2.0E-07
sp|P0AEJ1|EMRB_ECO57 Multidrug export protein EmrB OS=Escherichia coli O157:H7 GN=emrB PE=3 SV=1 15 342 2.0E-07
sp|B4T9U3|MDTD_SALHS Putative multidrug resistance protein MdtD OS=Salmonella heidelberg (strain SL476) GN=mdtD PE=3 SV=1 27 360 4.0E-07
sp|Q99S97|SDRM_STAAN Multidrug efflux pump SdrM OS=Staphylococcus aureus (strain N315) GN=sdrM PE=1 SV=1 32 188 4.0E-07
sp|B7LV41|MDTD_ESCF3 Putative multidrug resistance protein MdtD OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtD PE=3 SV=1 27 360 1.0E-06
sp|B4TNI8|MDTD_SALSV Putative multidrug resistance protein MdtD OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtD PE=3 SV=1 27 360 1.0E-06
sp|P9WJX3|Y1634_MYCTU Probable multidrug-efflux transporter Rv1634 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1634 PE=1 SV=1 41 198 2.0E-06
sp|P9WJX2|Y1634_MYCTO Probable multidrug-efflux transporter MT1670 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1670 PE=3 SV=1 41 198 2.0E-06
sp|B5BF67|MDTD_SALPK Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtD PE=3 SV=1 27 360 2.0E-06
sp|Q5PDW9|MDTD_SALPA Putative multidrug resistance protein MdtD OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtD PE=3 SV=1 27 360 2.0E-06
sp|B4SXW2|MDTD_SALNS Putative multidrug resistance protein MdtD OS=Salmonella newport (strain SL254) GN=mdtD PE=3 SV=1 27 360 2.0E-06
sp|B5R0C2|MDTD_SALEP Putative multidrug resistance protein MdtD OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtD PE=3 SV=1 27 360 2.0E-06
sp|B5EXV9|MDTD_SALA4 Putative multidrug resistance protein MdtD OS=Salmonella agona (strain SL483) GN=mdtD PE=3 SV=1 27 360 2.0E-06
sp|Q8Z5F5|MDTD_SALTI Putative multidrug resistance protein MdtD OS=Salmonella typhi GN=mdtD PE=3 SV=1 27 360 2.0E-06
sp|P76269|YEBQ_ECOLI Uncharacterized transporter YebQ OS=Escherichia coli (strain K12) GN=yebQ PE=3 SV=2 68 342 2.0E-06
sp|B5FMU8|MDTD_SALDC Putative multidrug resistance protein MdtD OS=Salmonella dublin (strain CT_02021853) GN=mdtD PE=3 SV=1 27 360 3.0E-06
sp|Q8ZNQ0|MDTD_SALTY Putative multidrug resistance protein MdtD OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtD PE=3 SV=1 27 360 3.0E-06
sp|A8ACM0|MDTL_CITK8 Multidrug resistance protein MdtL OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtL PE=3 SV=1 76 210 4.0E-06
sp|B4TAV4|MDTL_SALHS Multidrug resistance protein MdtL OS=Salmonella heidelberg (strain SL476) GN=mdtL PE=3 SV=1 76 222 4.0E-06
sp|Q8ZKY1|MDTL_SALTY Multidrug resistance protein MdtL OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtL PE=3 SV=1 76 215 5.0E-06
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 76 215 6.0E-06
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 76 215 6.0E-06
sp|Q8X1Z7|MIRA_EMENI Siderophore iron transporter mirA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mirA PE=3 SV=1 85 474 6.0E-06
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 76 215 6.0E-06
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 76 215 6.0E-06
sp|P9WJW9|Y2459_MYCTU Uncharacterized MFS-type transporter Rv2459 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2459 PE=3 SV=1 68 498 8.0E-06
sp|P9WJW8|Y2459_MYCTO Uncharacterized MFS-type transporter MT2534 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2534 PE=3 SV=1 68 498 8.0E-06
sp|A7MHI9|MDTD_CROS8 Putative multidrug resistance protein MdtD OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtD PE=3 SV=1 24 360 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.5

Transmembrane Domains

Domain # Start End Length
1 28 50 22
2 65 84 19
3 96 115 19
4 120 142 22
5 154 173 19
6 183 205 22
7 225 247 22
8 257 279 22
9 298 320 22
10 335 352 17
11 359 381 22
12 391 413 22
13 426 448 22
14 498 520 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6281
MDADCEKRDCSGSEDEQKPPREVHGIKWGLIVAALLSSLFLYALDNTVVANVQSKVVETYKRVDLVPWLGVSFAL
GSAASTLPWSKVYGMFSAKKLYIGATTVFMAASALCGAAPNVNAFIIGRAIAGVGGCGMYMGLLTLLSVTTSNTE
RPRYLSLTGFIWGIGTVLGPIVGGSLGESAATWRWAFYLNLLVGAVCAPVYVFLLPDFKPLAGTPFAQRAGRIDY
LGSLLSIGLLMCIIMAMNLGGVLWDWNSGRSIALFVLSGVLTIVFALQQIFCIGTTTEDRLFPMHFWKSRTMIAL
FFTMMLATFGSFIGIYYLPLYYQFTRGATAVETSVHLLPFILFLVAFNLVNGQYMGSTGYYYPWYIAGSALELIG
GVLLYTVDENTTNAKLYGYTIILGTGIGCFCQAGFAVAQMKVDASEIAYSVGFMTCAQMLGIVIGTGMSGALFIN
YSQQALARVFPQASASELADAIAGIASQLINSASAEKKAEAIHGITRAIQLAYVPIIAAGTICLICSLFMRREKV
FH*
Coding >Hirsu2|6281
ATGGACGCAGACTGCGAGAAGAGGGATTGTAGTGGGAGCGAGGATGAACAAAAGCCTCCACGCGAGGTCCATGGC
ATCAAGTGGGGATTGATCGTCGCAGCCCTGCTCTCTTCGCTGTTCCTCTATGCATTGGACAACACCGTCGTCGCC
AACGTTCAGTCCAAGGTTGTCGAGACTTACAAGCGCGTCGACCTCGTCCCATGGCTGGGCGTGTCTTTCGCCCTG
GGCTCCGCAGCCAGCACGTTGCCCTGGTCCAAGGTCTACGGCATGTTCTCGGCCAAGAAGCTCTACATTGGCGCC
ACGACCGTCTTCATGGCCGCCTCGGCGCTCTGCGGCGCCGCCCCCAACGTCAACGCCTTCATTATCGGGAGAGCG
ATCGCGGGTGTTGGTGGATGCGGGATGTACATGGGCTTGTTAACCCTCCTATCGGTTACCACCTCGAACACCGAG
CGGCCCAGATACCTTAGCCTCACGGGCTTCATATGGGGCATCGGCACCGTCCTGGGGCCTATTGTTGGGGGGTCT
TTGGGCGAAAGCGCAGCCACTTGGCGATGGGCATTCTACCTCAATCTCCTGGTCGGTGCCGTCTGCGCGCCAGTC
TACGTCTTCCTCCTTCCCGACTTCAAGCCTCTTGCGGGCACCCCGTTCGCCCAGAGGGCCGGCAGAATCGACTAC
CTCGGCTCCCTGCTCTCGATCGGCCTCTTGATGTGCATCATCATGGCCATGAACCTCGGCGGCGTGCTCTGGGAT
TGGAACAGCGGCAGGAGCATCGCGCTTTTTGTCCTGTCTGGTGTTCTTACAATCGTCTTTGCTCTTCAGCAAATC
TTCTGCATCGGCACCACGACAGAAGATCGCCTATTCCCCATGCACTTCTGGAAGAGCCGCACCATGATTGCCCTA
TTCTTTACCATGATGCTTGCGACCTTTGGCAGCTTCATAGGCATCTACTACCTCCCGCTATACTACCAGTTTACC
CGAGGCGCCACCGCAGTCGAAACATCAGTTCACCTACTCCCATTCATCCTTTTCCTGGTCGCCTTCAACCTGGTC
AACGGCCAATACATGGGAAGCACGGGATACTATTATCCGTGGTATATCGCGGGCTCTGCTCTCGAGCTCATCGGC
GGCGTCCTCCTCTACACCGTCGACGAGAACACCACCAACGCAAAGCTATACGGATACACAATCATTCTCGGCACC
GGAATCGGCTGTTTCTGCCAGGCCGGATTCGCTGTCGCCCAGATGAAGGTTGATGCGAGCGAGATTGCCTACAGC
GTAGGCTTCATGACTTGTGCCCAGATGCTGGGCATCGTCATAGGGACCGGAATGTCGGGCGCACTTTTCATCAAT
TACTCGCAACAGGCCCTCGCTCGCGTGTTCCCGCAAGCCTCTGCCAGCGAGCTTGCTGATGCTATTGCCGGAATC
GCTAGCCAGCTCATCAACTCTGCCTCTGCGGAGAAAAAGGCCGAGGCTATACACGGCATTACGAGGGCAATCCAG
CTGGCATACGTGCCAATCATCGCGGCGGGGACTATCTGCCTCATCTGCAGCTTGTTTATGAGGAGAGAAAAGGTC
TTCCATTAG
Transcript >Hirsu2|6281
ATGGACGCAGACTGCGAGAAGAGGGATTGTAGTGGGAGCGAGGATGAACAAAAGCCTCCACGCGAGGTCCATGGC
ATCAAGTGGGGATTGATCGTCGCAGCCCTGCTCTCTTCGCTGTTCCTCTATGCATTGGACAACACCGTCGTCGCC
AACGTTCAGTCCAAGGTTGTCGAGACTTACAAGCGCGTCGACCTCGTCCCATGGCTGGGCGTGTCTTTCGCCCTG
GGCTCCGCAGCCAGCACGTTGCCCTGGTCCAAGGTCTACGGCATGTTCTCGGCCAAGAAGCTCTACATTGGCGCC
ACGACCGTCTTCATGGCCGCCTCGGCGCTCTGCGGCGCCGCCCCCAACGTCAACGCCTTCATTATCGGGAGAGCG
ATCGCGGGTGTTGGTGGATGCGGGATGTACATGGGCTTGTTAACCCTCCTATCGGTTACCACCTCGAACACCGAG
CGGCCCAGATACCTTAGCCTCACGGGCTTCATATGGGGCATCGGCACCGTCCTGGGGCCTATTGTTGGGGGGTCT
TTGGGCGAAAGCGCAGCCACTTGGCGATGGGCATTCTACCTCAATCTCCTGGTCGGTGCCGTCTGCGCGCCAGTC
TACGTCTTCCTCCTTCCCGACTTCAAGCCTCTTGCGGGCACCCCGTTCGCCCAGAGGGCCGGCAGAATCGACTAC
CTCGGCTCCCTGCTCTCGATCGGCCTCTTGATGTGCATCATCATGGCCATGAACCTCGGCGGCGTGCTCTGGGAT
TGGAACAGCGGCAGGAGCATCGCGCTTTTTGTCCTGTCTGGTGTTCTTACAATCGTCTTTGCTCTTCAGCAAATC
TTCTGCATCGGCACCACGACAGAAGATCGCCTATTCCCCATGCACTTCTGGAAGAGCCGCACCATGATTGCCCTA
TTCTTTACCATGATGCTTGCGACCTTTGGCAGCTTCATAGGCATCTACTACCTCCCGCTATACTACCAGTTTACC
CGAGGCGCCACCGCAGTCGAAACATCAGTTCACCTACTCCCATTCATCCTTTTCCTGGTCGCCTTCAACCTGGTC
AACGGCCAATACATGGGAAGCACGGGATACTATTATCCGTGGTATATCGCGGGCTCTGCTCTCGAGCTCATCGGC
GGCGTCCTCCTCTACACCGTCGACGAGAACACCACCAACGCAAAGCTATACGGATACACAATCATTCTCGGCACC
GGAATCGGCTGTTTCTGCCAGGCCGGATTCGCTGTCGCCCAGATGAAGGTTGATGCGAGCGAGATTGCCTACAGC
GTAGGCTTCATGACTTGTGCCCAGATGCTGGGCATCGTCATAGGGACCGGAATGTCGGGCGCACTTTTCATCAAT
TACTCGCAACAGGCCCTCGCTCGCGTGTTCCCGCAAGCCTCTGCCAGCGAGCTTGCTGATGCTATTGCCGGAATC
GCTAGCCAGCTCATCAACTCTGCCTCTGCGGAGAAAAAGGCCGAGGCTATACACGGCATTACGAGGGCAATCCAG
CTGGCATACGTGCCAATCATCGCGGCGGGGACTATCTGCCTCATCTGCAGCTTGTTTATGAGGAGAGAAAAGGTC
TTCCATTAG
Gene >Hirsu2|6281
ATGGACGCAGACTGCGAGAAGAGGGATTGTAGTGGGAGCGAGGATGAACAAAAGCCTCCACGCGAGGTCCATGGC
ATCAAGGTAAGCTCGCACCCACATGTACTTCAACGTTGTGCGGACTCTATACCAACAACCAGCATGGTCTAGTGG
GGATTGATCGTCGCAGCCCTGCTCTCTTCGCTGTTCCTCTATGCATTGGACAACACCGTCGTCGCCAACGTTCAG
TCCAAGGTTGTCGAGACTTACAAGCGCGTCGACCTCGTCCCATGGCTGGGCGTGTCTTTCGCCCTGGGCTCCGCA
GCCAGCACGTTGCCCTGGTCCAAGGTCTACGGCATGTTCTCGGCCAAGAAGCTCTACATTGGCGCCACGACCGTC
TTCATGGCCGCCTCGGCGCTCTGCGGCGCCGCCCCCAACGTCAACGCCTTCATTATCGGGAGAGCGATCGCGGGT
GTTGGTGGATGCGGGATGTACATGGGCTTGTTAACCCTCCTATCGGTTACCACCTCGAACACCGAGCGGCCCAGA
TACCTTAGCCTCACGGGCTTCATATGGGGCATCGGCACCGTCCTGGGGCCTATTGTTGGGGGGTCTTTGGGCGAA
AGCGCAGCCACTTGGCGATGGGCATTCTACCTCAATCTCCTGGTCGGTGCCGTCTGCGCGCCAGTCTACGTCTTC
CTCCTTCCCGACTTCAAGCCTCTTGCGGGCACCCCGTTCGCCCAGAGGGCCGGCAGAATCGACTACCTCGGCTCC
CTGCTCTCGATCGGCCTCTTGATGTGCATCATCATGGCCATGAACCTCGGCGGCGTGCTCTGGGATTGGAACAGC
GGCAGGAGCATCGCGCTTTTTGTCCTGTCTGGTGTTCTTACAATCGTCTTTGCTCTTCAGCAAATCTTCTGCATC
GGCACCACGACAGAAGATCGCCTATTCCCCATGCACTTCTGGAAGAGCCGCACCATGATTGCCCTATTCTTTACC
ATGAGTTTGTGTCCCTTCTTCCAATCAGTCGCCAGACCTCAAACTGATGCGGTCCTACAGTGCTTGCGACCTTTG
GCAGCTTCATAGGCATCTACTACCTCCCGCTATACTACCAGTTTACCCGAGGCGCCACCGCAGTCGAAACATCAG
TTCACCTACTCCCATTCATCCTTTTCCTGGTCGCCTTCAACCTGGTCAACGGCCAATACATGGGAAGCACGGGAT
ACTATTATCCGTGGTATATCGCGGGCTCTGCTCTCGAGCTCATCGGCGGCGTCCTCCTCTGTAAGCCTCCACGCG
ATCCATCCATGCCTGGGCCCAGTGATGTAGGGTGGCCGTGGCTGACACGAAGAAACAGACACCGTCGACGAGAAC
ACCACCAACGCAAAGCTATACGGATACACAATCATTCTCGGCACCGGAATCGGCTGTTTCTGCCAGGCCGGATTC
GCTGTCGCCCAGATGAAGGTTGATGCGAGCGAGATTGCCTACAGCGTAGGCTTCATGACTTGTGCCCAGATGCTG
GGCATCGTCATAGGGACCGGAATGTCGGGCGCACTTTTCATCAATTACTCGCAACAGGCCCTCGCTCGCGTGTTC
CCGCAAGCCTCTGCCAGCGAGCTTGCTGATGCTATTGCCGGAATCGCTAGCCAGCTCATCAACTCTGCCTCTGCG
GAGAAAAAGGCCGAGGCTATACACGGCATTACGAGGGCAATCCAGCTGGCATACGTGCCAATCATCGCGGCGGGG
ACTATCTGCCTCATCTGCAGCTTGTTTATGAGGAGAGAAAAGGTCTTCCATTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail