© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Hirsu2|6278 |
| Gene name | |
| Location | Contig_32:29052..30515 |
| Strand | - |
| Gene length (bp) | 1463 |
| Transcript length (bp) | 1401 |
| Coding sequence length (bp) | 1401 |
| Protein length (aa) | 467 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00501 | AMP-binding | AMP-binding enzyme | 1.8E-74 | 62 | 439 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 61 | 453 | 1.0E-104 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 58 | 449 | 5.0E-104 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 57 | 462 | 2.0E-73 |
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 69 | 463 | 4.0E-65 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 69 | 460 | 4.0E-62 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 61 | 453 | 1.0E-104 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 58 | 449 | 5.0E-104 |
| sp|Q4WF61|NRPS3_ASPFU | Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 | 57 | 462 | 2.0E-73 |
| sp|Q4WZ44|NRPS7_ASPFU | Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 | 69 | 463 | 4.0E-65 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 69 | 460 | 4.0E-62 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 58 | 459 | 6.0E-62 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 45 | 463 | 7.0E-62 |
| sp|P09095|TYCA_BREPA | Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 | 37 | 459 | 1.0E-61 |
| sp|Q9L9G0|NOVH_STRNV | Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 | 57 | 462 | 2.0E-60 |
| sp|P0C062|GRSA_BREBE | Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 | 57 | 463 | 8.0E-60 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 57 | 459 | 3.0E-59 |
| sp|P0C061|GRSA_ANEMI | Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 | 57 | 463 | 2.0E-58 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 20 | 459 | 2.0E-58 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 58 | 459 | 4.0E-58 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 36 | 450 | 4.0E-58 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 57 | 463 | 4.0E-58 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 42 | 459 | 7.0E-57 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 62 | 459 | 2.0E-56 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 80 | 459 | 5.0E-56 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 38 | 459 | 1.0E-55 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 36 | 454 | 3.0E-55 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 13 | 466 | 4.0E-55 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 38 | 459 | 4.0E-55 |
| sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 57 | 465 | 5.0E-55 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 57 | 455 | 9.0E-55 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 58 | 466 | 9.0E-55 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 52 | 459 | 1.0E-54 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 52 | 459 | 1.0E-54 |
| sp|Q9R9I9|MYCC_BACIU | Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 | 57 | 459 | 3.0E-54 |
| sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 58 | 459 | 4.0E-54 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 57 | 459 | 2.0E-53 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 58 | 459 | 2.0E-53 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 16 | 459 | 6.0E-53 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 40 | 459 | 6.0E-53 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 50 | 459 | 1.0E-52 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 16 | 459 | 1.0E-52 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 57 | 459 | 2.0E-52 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 57 | 459 | 2.0E-52 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 57 | 463 | 2.0E-52 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 57 | 463 | 3.0E-52 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 56 | 455 | 3.0E-52 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 57 | 459 | 4.0E-52 |
| sp|Q9R9J1|MYCA_BACIU | Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 | 13 | 462 | 4.0E-52 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 58 | 459 | 4.0E-52 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 58 | 459 | 4.0E-52 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 57 | 462 | 8.0E-52 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 58 | 459 | 3.0E-51 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 54 | 463 | 4.0E-51 |
| sp|P0C064|GRSB_BREBE | Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 | 14 | 450 | 5.0E-51 |
| sp|P0C063|GRSB_ANEMI | Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 | 14 | 450 | 5.0E-51 |
| sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 68 | 450 | 5.0E-51 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 34 | 459 | 1.0E-50 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 56 | 456 | 2.0E-50 |
| sp|O68008|BACC_BACLI | Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 | 58 | 459 | 3.0E-50 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 57 | 450 | 3.0E-50 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 42 | 459 | 3.0E-50 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 57 | 463 | 3.0E-50 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 68 | 449 | 4.0E-50 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 49 | 459 | 4.0E-50 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 47 | 463 | 5.0E-50 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 80 | 461 | 1.0E-49 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 58 | 459 | 1.0E-49 |
| sp|P40806|PKSJ_BACSU | Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 | 57 | 462 | 1.0E-49 |
| sp|O30409|TYCC_BREPA | Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 | 57 | 459 | 2.0E-49 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 51 | 463 | 2.0E-49 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 57 | 460 | 2.0E-49 |
| sp|O31827|PPSE_BACSU | Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 | 57 | 463 | 3.0E-49 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 61 | 460 | 4.0E-49 |
| sp|P45745|DHBF_BACSU | Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 | 62 | 463 | 8.0E-49 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 56 | 459 | 1.0E-48 |
| sp|Q4WLW5|NRP12_ASPFU | Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 | 58 | 460 | 1.0E-48 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 14 | 462 | 1.0E-48 |
| sp|O30408|TYCB_BREPA | Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 | 56 | 456 | 2.0E-48 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 58 | 459 | 2.0E-48 |
| sp|P39846|PPSB_BACSU | Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 | 57 | 463 | 5.0E-48 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 58 | 460 | 2.0E-47 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 57 | 459 | 2.0E-47 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 57 | 450 | 2.0E-47 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 58 | 453 | 2.0E-47 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 57 | 450 | 5.0E-47 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 61 | 458 | 6.0E-47 |
| sp|P27742|ACVS_EMENI | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 | 53 | 463 | 9.0E-47 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 60 | 454 | 3.0E-46 |
| sp|Q9R9J0|MYCB_BACIU | Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 | 55 | 450 | 3.0E-46 |
| sp|Q08787|SRFAC_BACSU | Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 | 58 | 459 | 6.0E-46 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 19 | 459 | 6.0E-46 |
| sp|Q4WVN4|NRPS8_ASPFU | Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 | 80 | 454 | 1.0E-45 |
| sp|Q0VZ70|CHSAD_CHOCO | Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 | 56 | 459 | 1.0E-45 |
| sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 48 | 458 | 1.0E-45 |
| sp|Q70LM7|LGRA_BREPA | Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 | 58 | 459 | 2.0E-45 |
| sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 48 | 458 | 2.0E-45 |
| sp|O31782|PKSN_BACSU | Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 | 58 | 463 | 2.0E-45 |
| sp|Q01757|ACVS_STRCL | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 | 58 | 462 | 3.0E-45 |
| sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 21 | 455 | 3.0E-45 |
| sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 48 | 461 | 3.0E-45 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 48 | 451 | 5.0E-45 |
| sp|Q4WYG2|NRPS5_ASPFU | Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 | 55 | 455 | 6.0E-45 |
| sp|Q70LM4|LGRD_BREPA | Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 | 70 | 459 | 7.0E-45 |
| sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 51 | 453 | 8.0E-45 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 57 | 450 | 1.0E-44 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 80 | 459 | 1.0E-44 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 80 | 464 | 1.0E-44 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 56 | 459 | 1.0E-44 |
| sp|Q4WF53|NRPS4_ASPFU | Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 | 80 | 450 | 2.0E-44 |
| sp|Q04747|SRFAB_BACSU | Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 | 30 | 454 | 1.0E-43 |
| sp|Q9P7T1|SIB1_SCHPO | Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 | 83 | 453 | 1.0E-43 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 83 | 459 | 5.0E-43 |
| sp|P39847|PPSC_BACSU | Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 | 38 | 450 | 5.0E-43 |
| sp|P27206|SRFAA_BACSU | Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 | 25 | 462 | 2.0E-42 |
| sp|Q4WMJ7|NRP10_ASPFU | Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 | 45 | 456 | 2.0E-42 |
| sp|Q70LM5|LGRC_BREPA | Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 | 83 | 459 | 3.0E-42 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 56 | 459 | 3.0E-42 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 56 | 459 | 4.0E-42 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 57 | 461 | 7.0E-42 |
| sp|Q9P7T1|SIB1_SCHPO | Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 | 62 | 450 | 7.0E-42 |
| sp|P27743|ACVS_AMYLA | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 | 55 | 463 | 2.0E-41 |
| sp|Q70LM6|LGRB_BREPA | Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 | 83 | 459 | 4.0E-41 |
| sp|O68007|BACB_BACLI | Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 | 57 | 450 | 5.0E-41 |
| sp|P94459|PPSD_BACSU | Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 | 57 | 463 | 9.0E-41 |
| sp|P25464|ACVS_ACRCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 | 56 | 466 | 2.0E-40 |
| sp|P39845|PPSA_BACSU | Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 | 57 | 450 | 2.0E-40 |
| sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 81 | 461 | 2.0E-40 |
| sp|P29698|ENTF_SHIFL | Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 | 14 | 459 | 4.0E-40 |
| sp|Q4WLW8|NRP11_ASPFU | Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 | 56 | 453 | 5.0E-40 |
| sp|P11454|ENTF_ECOLI | Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 | 14 | 459 | 6.0E-40 |
| sp|Q4WAW3|FTMA_ASPFU | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 | 56 | 451 | 2.0E-39 |
| sp|B9WZX0|FTMA_ASPFM | Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 | 56 | 451 | 2.0E-39 |
| sp|Q8XBV9|ENTF_ECO57 | Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 | 14 | 459 | 2.0E-39 |
| sp|A1DA59|FTMA_NEOFI | Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 | 68 | 451 | 4.0E-39 |
| sp|P26046|ACVS2_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 57 | 459 | 5.0E-39 |
| sp|P19787|ACVS1_PENCH | N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 | 57 | 459 | 5.0E-39 |
| sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 83 | 450 | 1.0E-37 |
| sp|O68006|BACA_BACLI | Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 | 58 | 463 | 8.0E-37 |
| sp|Q01886|HTS1_COCCA | HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 | 80 | 463 | 2.0E-36 |
| sp|Q4WR82|NRPS2_ASPFU | Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 | 62 | 449 | 3.0E-36 |
| sp|Q4WYP0|NRPS6_ASPFU | Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 | 58 | 451 | 9.0E-34 |
| sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 34 | 464 | 3.0E-33 |
| sp|O43103|SID2_USTMA | Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 | 57 | 459 | 3.0E-33 |
| sp|Q4WMK2|NRPS9_ASPFU | Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 | 80 | 451 | 1.0E-32 |
| sp|Q4WYG2|NRPS5_ASPFU | Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 | 81 | 441 | 3.0E-31 |
| sp|E2JA29|DDAD_ENTAG | Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 | 58 | 463 | 8.0E-31 |
| sp|Q1B6A7|MBTB_MYCSS | Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 | 101 | 450 | 3.0E-30 |
| sp|Q00869|ESYN_FUSEQ | Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 | 38 | 463 | 8.0E-30 |
| sp|Q75BB3|LYS2_ASHGO | L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 | 84 | 457 | 1.0E-29 |
| sp|Q4L4U5|DLTA_STAHJ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 | 56 | 450 | 2.0E-29 |
| sp|Q4WMJ7|NRP10_ASPFU | Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 | 58 | 451 | 2.0E-28 |
| sp|Q6FMI5|LYS2_CANGA | L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 | 58 | 459 | 3.0E-26 |
| sp|O74298|LYS2_PENCH | L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 | 84 | 459 | 3.0E-26 |
| sp|B8DEG2|DLTA_LISMH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 | 117 | 463 | 5.0E-26 |
| sp|Q721J2|DLTA_LISMF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 | 117 | 463 | 6.0E-26 |
| sp|Q8Y8D4|DLTA_LISMO | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 | 117 | 463 | 1.0E-25 |
| sp|Q92D47|DLTA_LISIN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 | 117 | 463 | 1.0E-25 |
| sp|B3WC77|DLTA_LACCB | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 | 68 | 450 | 1.0E-25 |
| sp|Q03AZ2|DLTA_LACC3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 | 68 | 450 | 2.0E-25 |
| sp|A2RE45|DLTA_STRPG | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 | 84 | 459 | 2.0E-25 |
| sp|Q1JGF0|DLTA_STRPD | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 | 84 | 459 | 2.0E-25 |
| sp|Q8P0J9|DLTA_STRP8 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 | 84 | 459 | 2.0E-25 |
| sp|B5XLX5|DLTA_STRPZ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 | 84 | 459 | 2.0E-25 |
| sp|A7ZA74|DLTA_BACMF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 | 80 | 463 | 3.0E-25 |
| sp|Q48SZ3|DLTA_STRPM | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 | 84 | 459 | 3.0E-25 |
| sp|Q8CT93|DLTA_STAES | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 | 61 | 450 | 3.0E-25 |
| sp|P35854|DLTA_LACRH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 | 68 | 450 | 3.0E-25 |
| sp|Q1J667|DLTA_STRPF | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 | 84 | 459 | 4.0E-25 |
| sp|C1L1P5|DLTA_LISMC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 | 117 | 463 | 4.0E-25 |
| sp|P0DA65|DLTA_STRPQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 | 84 | 459 | 6.0E-25 |
| sp|P0DA64|DLTA_STRP3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 | 84 | 459 | 6.0E-25 |
| sp|C0MBD6|DLTA_STRE4 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 | 84 | 459 | 7.0E-25 |
| sp|Q1JLB7|DLTA_STRPC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 | 84 | 459 | 7.0E-25 |
| sp|Q5XBN5|DLTA_STRP6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 | 84 | 459 | 7.0E-25 |
| sp|Q99ZA6|DLTA_STRP1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 | 84 | 459 | 7.0E-25 |
| sp|P07702|LYS2_YEAST | L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 | 58 | 459 | 1.0E-24 |
| sp|A0AH92|DLTA_LISW6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 | 68 | 463 | 2.0E-24 |
| sp|A9VKV6|DLTA_BACWK | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 | 63 | 450 | 2.0E-24 |
| sp|Q73BD2|DLTA_BACC1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 | 63 | 450 | 2.0E-24 |
| sp|A7GMR0|DLTA_BACCN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 | 80 | 450 | 2.0E-24 |
| sp|B7IN64|DLTA_BACC2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 | 60 | 450 | 3.0E-24 |
| sp|B9IUW2|DLTA_BACCQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 | 63 | 450 | 4.0E-24 |
| sp|Q6HLH7|DLTA_BACHK | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 | 63 | 450 | 5.0E-24 |
| sp|C1EM80|DLTA_BACC3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 | 63 | 450 | 5.0E-24 |
| sp|B7JFV5|DLTA_BACC0 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 | 63 | 450 | 5.0E-24 |
| sp|A0RBJ0|DLTA_BACAH | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 | 63 | 450 | 5.0E-24 |
| sp|P40976|LYS2_SCHPO | L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 | 80 | 459 | 5.0E-24 |
| sp|Q63E02|DLTA_BACCZ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 | 63 | 450 | 5.0E-24 |
| sp|B7HK95|DLTA_BACC7 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 | 63 | 450 | 7.0E-24 |
| sp|Q81G39|DLTA_BACCR | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 | 80 | 450 | 7.0E-24 |
| sp|B7HHC6|DLTA_BACC4 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 | 80 | 450 | 7.0E-24 |
| sp|Q5HQN0|DLTA_STAEQ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 | 61 | 450 | 7.0E-24 |
| sp|Q81T97|DLTA_BACAN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 | 63 | 450 | 8.0E-24 |
| sp|C3LAH8|DLTA_BACAC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 | 63 | 450 | 8.0E-24 |
| sp|C3P4I7|DLTA_BACAA | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 | 63 | 450 | 8.0E-24 |
| sp|Q00868|ESYN_GIBPU | Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 | 123 | 463 | 1.0E-23 |
| sp|Q73XY1|MBTB_MYCPA | Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 | 107 | 459 | 1.0E-23 |
| sp|P39581|DLTA_BACSU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 | 117 | 463 | 2.0E-23 |
| sp|Q8VM67|DLTA_STRA3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 | 84 | 451 | 4.0E-22 |
| sp|P59591|DLTA_STRA5 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 | 84 | 451 | 7.0E-22 |
| sp|Q3JZ94|DLTA_STRA1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 | 84 | 451 | 7.0E-22 |
| sp|P9WQ63|MBTB_MYCTU | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 | 62 | 459 | 1.0E-21 |
| sp|Q7TYQ4|MBTB_MYCBO | Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 | 62 | 459 | 1.0E-21 |
| sp|P68878|DLTA_STAAW | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 | 69 | 450 | 1.0E-21 |
| sp|A8Z1J1|DLTA_STAAT | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 | 69 | 450 | 1.0E-21 |
| sp|Q6GAZ4|DLTA_STAAS | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 | 69 | 450 | 1.0E-21 |
| sp|A6QFE3|DLTA_STAAE | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 | 69 | 450 | 1.0E-21 |
| sp|Q5HHF2|DLTA_STAAC | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 | 69 | 450 | 1.0E-21 |
| sp|Q2FZW6|DLTA_STAA8 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 | 69 | 450 | 1.0E-21 |
| sp|Q2FIE3|DLTA_STAA3 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 | 69 | 450 | 1.0E-21 |
| sp|P9WQ62|MBTB_MYCTO | Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 | 62 | 459 | 1.0E-21 |
| sp|Q53526|DLTA_STRMU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 | 84 | 455 | 2.0E-21 |
| sp|Q2YWQ8|DLTA_STAAB | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 | 69 | 450 | 2.0E-21 |
| sp|Q9X2N4|DLTA_STAXY | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 | 58 | 450 | 2.0E-21 |
| sp|Q6GIF6|DLTA_STAAR | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 | 69 | 450 | 2.0E-21 |
| sp|P0DJH0|ANGR_VIBAN | Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 | 101 | 462 | 2.0E-21 |
| sp|Q6W4T3|ANGR_VIBA7 | Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 | 101 | 462 | 2.0E-21 |
| sp|P0C397|DLTA_STAAU | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 | 69 | 450 | 4.0E-21 |
| sp|P99107|DLTA_STAAN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 | 69 | 450 | 4.0E-21 |
| sp|P68876|DLTA_STAAM | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 | 69 | 450 | 4.0E-21 |
| sp|A5IRB0|DLTA_STAA9 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 | 69 | 450 | 4.0E-21 |
| sp|A6U039|DLTA_STAA2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 | 69 | 450 | 4.0E-21 |
| sp|A7X0D6|DLTA_STAA1 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 | 69 | 450 | 4.0E-21 |
| sp|Q4WAZ9|NRP14_ASPFU | Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 | 57 | 455 | 2.0E-20 |
| sp|C1CB20|DLTA_STRP7 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 | 84 | 455 | 2.0E-20 |
| sp|C1CNE9|DLTA_STRZP | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 | 84 | 455 | 2.0E-20 |
| sp|P0A399|DLTA_STRR6 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 | 84 | 455 | 2.0E-20 |
| sp|P0A398|DLTA_STRPN | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 | 84 | 455 | 2.0E-20 |
| sp|Q04HZ7|DLTA_STRP2 | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 | 84 | 455 | 2.0E-20 |
| sp|C1CU95|DLTA_STRZT | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 | 84 | 455 | 5.0E-20 |
| sp|B8ZQ14|DLTA_STRPJ | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 | 84 | 455 | 5.0E-20 |
| sp|Q4WT66|NRPS1_ASPFU | Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 | 58 | 466 | 7.0E-20 |
| sp|Q12572|LYS2_CANAX | L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 | 58 | 459 | 9.0E-20 |
| sp|Q88VM6|DLTA_LACPL | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 | 84 | 456 | 1.0E-19 |
| sp|O07610|LCFB_BACSU | Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 | 58 | 459 | 2.0E-19 |
| sp|A1CLY8|CCSA_ASPCL | Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 | 55 | 454 | 2.0E-19 |
| sp|Q65DH1|DLTA_BACLD | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 | 79 | 450 | 4.0E-19 |
| sp|Q84P24|4CLL6_ARATH | 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 | 95 | 463 | 5.0E-18 |
| sp|Q9I4X3|PQSA_PSEAE | Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 | 41 | 456 | 3.0E-17 |
| sp|Q6ETN3|4CL3_ORYSJ | Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 | 71 | 459 | 4.0E-17 |
| sp|A8FGK6|MENE_BACP2 | 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 | 70 | 459 | 6.0E-17 |
| sp|P80436|TRS1_STRTI | Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 | 58 | 459 | 9.0E-17 |
| sp|Q9LU36|4CL4_ARATH | 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 | 177 | 459 | 1.0E-16 |
| sp|P86832|CBCL2_ARTSP | 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 | 106 | 463 | 1.0E-16 |
| sp|P86831|CBCL1_ARTSP | 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 | 106 | 463 | 1.0E-16 |
| sp|Q42982|4CL2_ORYSJ | Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 | 153 | 463 | 2.0E-16 |
| sp|Q9S725|4CL2_ARATH | 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 | 61 | 466 | 2.0E-16 |
| sp|Q4R4Z9|ACSF2_MACFA | Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 | 52 | 459 | 2.0E-16 |
| sp|Q5R9G9|ACSF2_PONAB | Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 | 51 | 459 | 4.0E-16 |
| sp|Q96CM8|ACSF2_HUMAN | Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 | 51 | 459 | 4.0E-16 |
| sp|Q10S72|4CLL4_ORYSJ | 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 | 190 | 463 | 9.0E-16 |
| sp|Q499N5|ACSF2_RAT | Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 | 199 | 459 | 1.0E-15 |
| sp|P41636|4CL_PINTA | 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 | 102 | 463 | 1.0E-15 |
| sp|O24145|4CL1_TOBAC | 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 | 59 | 459 | 2.0E-15 |
| sp|O74976|FAT2_SCHPO | Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 | 193 | 459 | 2.0E-15 |
| sp|P10378|ENTE_ECOLI | Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 | 78 | 463 | 3.0E-15 |
| sp|Q65FT5|MENE_BACLD | 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 | 70 | 459 | 3.0E-15 |
| sp|Q17QJ1|ACSF2_BOVIN | Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 | 199 | 457 | 3.0E-15 |
| sp|P69451|LCFA_ECOLI | Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 | 61 | 463 | 4.0E-15 |
| sp|P69452|LCFA_ECOL6 | Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 | 61 | 463 | 4.0E-15 |
| sp|P0C5B6|4CLL4_ARATH | 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 | 83 | 463 | 7.0E-15 |
| sp|Q8XDR6|LCFA_ECO57 | Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 | 61 | 463 | 9.0E-15 |
| sp|Q8XBV3|ENTE_ECO57 | Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 | 78 | 463 | 1.0E-14 |
| sp|Q8VCW8|ACSF2_MOUSE | Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 | 199 | 459 | 1.0E-14 |
| sp|Q0K844|SAUT_CUPNH | Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 | 78 | 463 | 2.0E-14 |
| sp|Q8H151|AAE13_ARATH | Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 | 173 | 462 | 2.0E-14 |
| sp|P96575|YDAB_BACSU | Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 | 191 | 463 | 2.0E-14 |
| sp|O31826|YNGI_BACSU | Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 | 191 | 460 | 2.0E-14 |
| sp|Q9CG49|DLTA_LACLA | D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 | 78 | 450 | 2.0E-14 |
| sp|Q67W82|4CL4_ORYSJ | Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 | 84 | 459 | 4.0E-14 |
| sp|Q8GQN9|BCLA_THAAR | Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 | 87 | 463 | 6.0E-14 |
| sp|B7HTW3|MENE_BACC7 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 | 70 | 459 | 7.0E-14 |
| sp|C5D6U5|MENE_GEOSW | 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 | 56 | 459 | 8.0E-14 |
| sp|P63521|LCFA_SALTY | Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 | 57 | 463 | 8.0E-14 |
| sp|P63522|LCFA_SALTI | Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 | 57 | 463 | 8.0E-14 |
| sp|Q9L9F6|NOVL_STRNV | 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 | 126 | 460 | 9.0E-14 |
| sp|Q72YK9|MENE_BACC1 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 | 70 | 459 | 1.0E-13 |
| sp|P48633|HMWP2_YERE8 | High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 | 101 | 466 | 1.0E-13 |
| sp|Q9S777|4CL3_ARATH | 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 | 84 | 463 | 1.0E-13 |
| sp|Q84P21|4CLL5_ARATH | 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 | 83 | 463 | 2.0E-13 |
| sp|A7Z809|MENE_BACMF | 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 | 70 | 459 | 2.0E-13 |
| sp|B9J2F2|MENE_BACCQ | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 | 70 | 459 | 3.0E-13 |
| sp|Q632I5|MENE_BACCZ | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 | 70 | 459 | 5.0E-13 |
| sp|Q6ZAC1|4CL5_ORYSJ | Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 | 61 | 454 | 6.0E-13 |
| sp|P17814|4CL1_ORYSJ | Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 | 101 | 463 | 6.0E-13 |
| sp|B7JDD6|MENE_BACC0 | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 | 57 | 459 | 1.0E-12 |
| sp|Q5KVX9|MENE_GEOKA | 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 | 56 | 459 | 1.0E-12 |
| sp|P31684|4CL1_SOLTU | 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 | 59 | 459 | 2.0E-12 |
| sp|Q816I1|MENE_BACCR | 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 | 70 | 459 | 2.0E-12 |
| sp|F4K1G2|AEE19_ARATH | Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 | 114 | 459 | 2.0E-12 |
| sp|P31687|4CL2_SOYBN | 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 | 84 | 463 | 2.0E-12 |
| sp|P94547|LCFA_BACSU | Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 | 49 | 459 | 3.0E-12 |
| sp|Q6HC29|MENE_BACHK | 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 | 57 | 459 | 4.0E-12 |
| sp|Q9M0X9|4CLL7_ARATH | 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 | 56 | 460 | 5.0E-12 |
| sp|Q3E6Y4|4CLL3_ARATH | 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 | 83 | 463 | 6.0E-12 |
| sp|Q0S7V5|FAD3_RHOJR | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 | 78 | 463 | 6.0E-12 |
| sp|A0RK73|MENE_BACAH | 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 | 57 | 459 | 6.0E-12 |
| sp|Q554Z5|ACSB_DICDI | Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 | 198 | 463 | 6.0E-12 |
| sp|O93730|ACSA_PYRAE | Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 | 197 | 463 | 7.0E-12 |
| sp|Q7XXL2|4CLL9_ORYSJ | 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 | 84 | 459 | 8.0E-12 |
| sp|P31685|4CL2_SOLTU | 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 | 59 | 459 | 8.0E-12 |
| sp|Q6AYT9|ACSM5_RAT | Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 | 70 | 463 | 9.0E-12 |
| sp|Q8ZES9|LCFA_YERPE | Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 | 56 | 463 | 1.0E-11 |
| sp|Q84P23|4CLL9_ARATH | 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 | 83 | 463 | 1.0E-11 |
| sp|Q53FZ2|ACSM3_HUMAN | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 | 68 | 463 | 1.0E-11 |
| sp|O24540|4CL_VANPL | 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 | 59 | 459 | 1.0E-11 |
| sp|P38135|FADK_ECOLI | Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 | 57 | 459 | 2.0E-11 |
| sp|O24146|4CL2_TOBAC | 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 | 59 | 459 | 2.0E-11 |
| sp|P9WQ37|FAC13_MYCTU | Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 | 75 | 463 | 2.0E-11 |
| sp|P9WQ36|FAC13_MYCTO | Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 | 75 | 463 | 2.0E-11 |
| sp|P23971|MENE_BACSU | 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 | 70 | 459 | 2.0E-11 |
| sp|Q5REV5|ACSM3_PONAB | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 | 68 | 463 | 2.0E-11 |
| sp|Q81K97|MENE_BACAN | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 | 57 | 459 | 2.0E-11 |
| sp|C3LB87|MENE_BACAC | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 | 57 | 459 | 2.0E-11 |
| sp|C3PCK3|MENE_BACAA | 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 | 57 | 459 | 2.0E-11 |
| sp|Q3UNX5|ACSM3_MOUSE | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 | 121 | 463 | 4.0E-11 |
| sp|Q8BGA8|ACSM5_MOUSE | Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 | 70 | 463 | 4.0E-11 |
| sp|Q8VZF1|AEE7_ARATH | Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 | 201 | 463 | 5.0E-11 |
| sp|Q6GFR0|MENE_STAAR | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 | 78 | 460 | 5.0E-11 |
| sp|Q8RU95|4CLL6_ORYSJ | 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 | 82 | 463 | 8.0E-11 |
| sp|Q8ENZ7|MENE_OCEIH | 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 | 70 | 455 | 8.0E-11 |
| sp|A7GU88|MENE_BACCN | 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 | 70 | 463 | 9.0E-11 |
| sp|Q27757|LUCI_PHOPE | Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 | 81 | 460 | 2.0E-10 |
| sp|Q0P4F7|ACSF2_DANRE | Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 | 171 | 461 | 2.0E-10 |
| sp|A9VM74|MENE_BACWK | 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 | 70 | 461 | 2.0E-10 |
| sp|B4TUM9|AAS_SALSV | Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 | 170 | 454 | 2.0E-10 |
| sp|Q01576|ACSA_PHYB8 | Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 | 67 | 463 | 2.0E-10 |
| sp|Q8ZMA4|AAS_SALTY | Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 | 170 | 454 | 2.0E-10 |
| sp|A9N3H8|AAS_SALPB | Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 | 170 | 454 | 2.0E-10 |
| sp|B4TGR5|AAS_SALHS | Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 | 170 | 454 | 2.0E-10 |
| sp|B5QWU2|AAS_SALEP | Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 | 170 | 454 | 2.0E-10 |
| sp|B4T503|AAS_SALNS | Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 | 170 | 454 | 2.0E-10 |
| sp|B5F4V4|AAS_SALA4 | Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 | 170 | 454 | 2.0E-10 |
| sp|B5RDY6|AAS_SALG2 | Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 | 170 | 454 | 2.0E-10 |
| sp|Q8Z406|AAS_SALTI | Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 | 170 | 454 | 2.0E-10 |
| sp|B5BFH6|AAS_SALPK | Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 | 170 | 454 | 3.0E-10 |
| sp|Q5PEN7|AAS_SALPA | Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 | 170 | 454 | 3.0E-10 |
| sp|C0SPB0|YTCI_BACSU | Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 | 72 | 463 | 3.0E-10 |
| sp|P9WQ55|FAD10_MYCTU | Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 | 56 | 452 | 3.0E-10 |
| sp|P9WQ54|FAD10_MYCTO | Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 | 56 | 452 | 3.0E-10 |
| sp|A1JIK3|ACSA_YERE8 | Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 | 40 | 463 | 3.0E-10 |
| sp|Q9SMT7|4CLLA_ARATH | Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 | 325 | 459 | 3.0E-10 |
| sp|Q6SKG1|ACSM3_RAT | Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 | 67 | 463 | 3.0E-10 |
| sp|A7MR36|AAS_CROS8 | Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 | 170 | 454 | 3.0E-10 |
| sp|Q6D107|AAS_PECAS | Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 | 193 | 455 | 3.0E-10 |
| sp|Q9CHK3|MENE_LACLA | 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 | 73 | 463 | 3.0E-10 |
| sp|B5FUB9|AAS_SALDC | Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 | 170 | 454 | 4.0E-10 |
| sp|C0PXJ8|AAS_SALPC | Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 | 170 | 454 | 4.0E-10 |
| sp|Q57KA7|AAS_SALCH | Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 | 170 | 454 | 4.0E-10 |
| sp|Q42524|4CL1_ARATH | 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 | 188 | 463 | 5.0E-10 |
| sp|P38137|FAT2_YEAST | Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 | 196 | 459 | 5.0E-10 |
| sp|A6TDH2|AAS_KLEP7 | Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 | 72 | 454 | 6.0E-10 |
| sp|F4HUK6|AAE1_ARATH | Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 | 201 | 463 | 7.0E-10 |
| sp|P08659|LUCI_PHOPY | Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 | 168 | 460 | 8.0E-10 |
| sp|C6DE43|AAS_PECCP | Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 | 193 | 455 | 8.0E-10 |
| sp|A8AP56|AAS_CITK8 | Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 | 188 | 454 | 9.0E-10 |
| sp|P46450|LCFA_HAEIN | Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 | 57 | 454 | 1.0E-09 |
| sp|Q53005|4HBCL_RHOPA | 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 | 194 | 463 | 1.0E-09 |
| sp|P18163|ACSL1_RAT | Long-chain-fatty-acid--CoA ligase 1 OS=Rattus norvegicus GN=Acsl1 PE=1 SV=1 | 192 | 459 | 1.0E-09 |
| sp|Q84P25|4CLL2_ARATH | 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 | 99 | 463 | 1.0E-09 |
| sp|Q8FEA6|AAS_ECOL6 | Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 | 188 | 454 | 1.0E-09 |
| sp|B7UHQ4|AAS_ECO27 | Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 | 188 | 454 | 1.0E-09 |
| sp|O68040|ACSA_RHOCB | Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 | 67 | 463 | 1.0E-09 |
| sp|B7LNJ2|AAS_ESCF3 | Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 | 188 | 454 | 1.0E-09 |
| sp|Q7WSH3|FADD3_COMTE | 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 | 46 | 457 | 2.0E-09 |
| sp|Q53634|MENE_STAAU | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 | 78 | 459 | 2.0E-09 |
| sp|A8Z4L9|MENE_STAAT | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 | 78 | 459 | 2.0E-09 |
| sp|A6QHX6|MENE_STAAE | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 | 78 | 459 | 2.0E-09 |
| sp|Q5HEY2|MENE_STAAC | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 | 78 | 459 | 2.0E-09 |
| sp|Q2G2V3|MENE_STAA8 | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 | 78 | 459 | 2.0E-09 |
| sp|Q2FFU9|MENE_STAA3 | 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 | 78 | 459 | 2.0E-09 |
| sp|Q6NUN0|ACSM5_HUMAN | Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 | 70 | 463 | 2.0E-09 |
| sp|Q0TDZ6|AAS_ECOL5 | Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|Q1R7H5|AAS_ECOUT | Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|A1AF47|AAS_ECOK1 | Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|B7MLI2|AAS_ECO45 | Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|B5XUP2|AAS_KLEP3 | Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 | 170 | 454 | 3.0E-09 |
| sp|P31119|AAS_ECOLI | Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 | 188 | 454 | 3.0E-09 |
| sp|B1XDP2|AAS_ECODH | Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|C4ZZY9|AAS_ECOBW | Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|B1IU08|AAS_ECOLC | Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|A8A3X0|AAS_ECOHS | Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|A7ZQU2|AAS_ECO24 | Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|Q9JID6|ACSL1_CAVPO | Long-chain-fatty-acid--CoA ligase 1 OS=Cavia porcellus GN=ACSL1 PE=2 SV=1 | 192 | 459 | 3.0E-09 |
| sp|B5Z4F4|AAS_ECO5E | Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|Q8X6J8|AAS_ECO57 | Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|B2TYQ5|AAS_SHIB3 | Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|Q3YY21|AAS_SHISS | Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|B6I6W1|AAS_ECOSE | Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|B7LF13|AAS_ECO55 | Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|B7N768|AAS_ECOLU | Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|Q83JV7|AAS_SHIFL | Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|Q0T128|AAS_SHIF8 | Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 | 188 | 454 | 3.0E-09 |
| sp|B1LR34|AAS_ECOSM | Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 | 188 | 454 | 4.0E-09 |
| sp|Q9AJS8|3HBCL_THAAR | 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 | 80 | 459 | 4.0E-09 |
| sp|A4WE11|AAS_ENT38 | Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 | 170 | 452 | 4.0E-09 |
| sp|P37353|MENE_ECOLI | 2-succinylbenzoate--CoA ligase OS=Escherichia coli (strain K12) GN=menE PE=1 SV=2 | 193 | 461 | 6.0E-09 |
| sp|Q8EYG2|ACSA_LEPIN | Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 | 64 | 463 | 6.0E-09 |
| sp|A4TLD3|AAS_YERPP | Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 | 194 | 454 | 6.0E-09 |
| sp|A9R2S1|AAS_YERPG | Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 | 194 | 454 | 6.0E-09 |
| sp|Q72LY9|ACSA_LEPIC | Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 | 64 | 463 | 7.0E-09 |
| sp|B1JQC1|AAS_YERPY | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 | 194 | 454 | 7.0E-09 |
| sp|Q667F1|AAS_YERPS | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 | 194 | 454 | 7.0E-09 |
| sp|B2JZ75|AAS_YERPB | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 | 194 | 454 | 7.0E-09 |
| sp|A7FFD1|AAS_YERP3 | Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 | 194 | 454 | 7.0E-09 |
| sp|B2VFS7|AAS_ERWT9 | Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 | 192 | 452 | 8.0E-09 |
| sp|Q74RZ6|AAS_YERPE | Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 | 194 | 454 | 9.0E-09 |
| sp|Q1CAS8|AAS_YERPA | Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 | 194 | 454 | 9.0E-09 |
| sp|Q92AY8|MENE_LISIN | 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 | 58 | 463 | 1.0E-08 |
| sp|A7HSR8|ACSA_PARL1 | Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 | 13 | 463 | 1.0E-08 |
| sp|Q9P7T1|SIB1_SCHPO | Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 | 58 | 435 | 2.0E-08 |
| sp|P14912|4CL1_PETCR | 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 | 58 | 459 | 2.0E-08 |
| sp|Q7TN78|ACSM4_RAT | Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 | 199 | 463 | 2.0E-08 |
| sp|Q84HC5|NCSB2_STRCZ | 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 | 97 | 463 | 3.0E-08 |
| sp|O14975|S27A2_HUMAN | Very long-chain acyl-CoA synthetase OS=Homo sapiens GN=SLC27A2 PE=1 SV=2 | 57 | 453 | 3.0E-08 |
| sp|A1U2S9|ACSA_MARHV | Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 | 60 | 463 | 4.0E-08 |
| sp|Q80W40|ACSM4_MOUSE | Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 | 70 | 463 | 4.0E-08 |
| sp|P37418|MENE_SALTY | 2-succinylbenzoate--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=menE PE=3 SV=2 | 118 | 459 | 5.0E-08 |
| sp|P14913|4CL2_PETCR | 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 | 58 | 459 | 7.0E-08 |
| sp|P41216|ACSL1_MOUSE | Long-chain-fatty-acid--CoA ligase 1 OS=Mus musculus GN=Acsl1 PE=1 SV=2 | 192 | 459 | 7.0E-08 |
| sp|P58730|MENE_LISMO | 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 | 58 | 463 | 1.0E-07 |
| sp|Q6YYZ2|4CLL3_ORYSJ | 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 | 56 | 463 | 1.0E-07 |
| sp|A1JPF0|AAS_YERE8 | Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 | 194 | 455 | 1.0E-07 |
| sp|Q69RG7|4CLL7_ORYSJ | 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 | 197 | 463 | 1.0E-07 |
| sp|P44565|MENE_HAEIN | 2-succinylbenzoate--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=menE PE=3 SV=1 | 197 | 459 | 2.0E-07 |
| sp|P19409|BAIB_CLOSV | Bile acid-coenzyme A ligase OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiB PE=1 SV=1 | 78 | 460 | 2.0E-07 |
| sp|O07619|YHFT_BACSU | Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 | 57 | 459 | 2.0E-07 |
| sp|P9WQ39|MENE_MYCTU | Probable 2-succinylbenzoate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menE PE=1 SV=1 | 194 | 463 | 2.0E-07 |
| sp|P9WQ38|MENE_MYCTO | Probable 2-succinylbenzoate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menE PE=3 SV=1 | 194 | 463 | 2.0E-07 |
| sp|Q9SS01|AAE20_ARATH | Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 | 376 | 463 | 2.0E-07 |
| sp|O07899|VIBE_VIBCH | Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 | 143 | 459 | 3.0E-07 |
| sp|Q9LQS1|AAE8_ARATH | Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 | 201 | 463 | 3.0E-07 |
| sp|Q8JZR0|ACSL5_MOUSE | Long-chain-fatty-acid--CoA ligase 5 OS=Mus musculus GN=Acsl5 PE=1 SV=1 | 328 | 461 | 3.0E-07 |
| sp|Q9C8D4|AAE11_ARATH | Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 | 201 | 463 | 3.0E-07 |
| sp|Q9SS00|AAE12_ARATH | Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 | 376 | 463 | 3.0E-07 |
| sp|Q84P26|4CLL8_ARATH | 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 | 80 | 463 | 4.0E-07 |
| sp|A7MPJ7|ACSA_CROS8 | Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 | 198 | 463 | 4.0E-07 |
| sp|O88813|ACSL5_RAT | Long-chain-fatty-acid--CoA ligase 5 OS=Rattus norvegicus GN=Acsl5 PE=1 SV=1 | 328 | 452 | 5.0E-07 |
| sp|Q9FFE6|AAE5_ARATH | Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 | 201 | 459 | 5.0E-07 |
| sp|Q9C9G2|AEE22_ARATH | Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 | 376 | 463 | 6.0E-07 |
| sp|Q9LQ12|4CLL1_ARATH | 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 | 83 | 459 | 8.0E-07 |
| sp|Q71YZ5|MENE_LISMF | 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 | 197 | 463 | 2.0E-06 |
| sp|Q7N7A9|AAS_PHOLL | Bifunctional protein Aas OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aas PE=3 SV=1 | 192 | 445 | 3.0E-06 |
| sp|Q5LRT0|DMDB_RUEPO | 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 | 195 | 463 | 7.0E-06 |
| sp|O80658|AAE4_ARATH | Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 | 201 | 463 | 9.0E-06 |
| sp|P40871|DHBE_BACSU | 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 | 375 | 459 | 1.0E-05 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 29 | 0.45 |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Hirsu2|6278 MAIVAHVPNPSPYRAVTSSLLTKPLTLTYDVDTRYDIETRRISRDPHKDVRHVQPTTISRLFENTVLRNPARPAV QYENDEPVTFGQLNTASNKLARTLKLKPGSIVPVCLDRSVDLIISLLAILKSGAAYTILDPDAPSRRAQAIIETC NATQILVQRKHASRFSCPTWVMEDVASESIQQDGSNLSLKVSPDTVAYIIFTSGSTGTPKGVVVTHSAATAGMAC HNLHGLSRWLLFFNPVFSAAQRTMLSTLVHGALLLLASKERLASNLSSLVREMNVDALGITPSALSALRPDAIPS VKRITLVGERIPQEIVNAWADKVVLCNSYGLSECTQINFSQRLSPGSNPRIVGRPIDTTTAYVMEPSSLNLAPVG TQGELCLTGAQLAQGYLGLPEETARVFIPNPFGHGRMYRTGDVAKTHPDGSIEIVGRIDFQAKIGGQKVDPSEVD EVVVKHPAVIRCAEQD* |
| Coding | >Hirsu2|6278 ATGGCAATCGTCGCTCACGTTCCCAACCCTTCTCCGTACCGCGCGGTCACAAGTTCACTCTTGACGAAGCCGCTG ACCCTGACGTACGATGTCGACACACGCTATGACATTGAGACGAGACGCATTTCCCGTGATCCTCACAAGGATGTC CGCCACGTCCAGCCGACAACTATAAGTCGTCTCTTCGAAAACACAGTCCTCAGAAACCCAGCCAGGCCGGCCGTT CAGTACGAAAATGATGAACCCGTCACGTTTGGCCAGCTCAATACCGCGTCAAACAAGCTTGCTCGGACGCTGAAG CTCAAGCCCGGATCGATTGTCCCCGTCTGCCTGGACCGCTCCGTTGATCTCATCATATCCTTGCTGGCCATCCTC AAGTCAGGGGCAGCATACACCATACTTGATCCCGATGCTCCGTCTCGGCGAGCCCAGGCCATCATCGAGACTTGC AATGCCACCCAAATCCTAGTGCAGCGCAAGCATGCCAGCCGCTTCAGCTGCCCGACCTGGGTGATGGAAGATGTC GCTAGCGAATCTATACAGCAGGACGGCTCCAACCTGAGCCTTAAGGTTTCGCCAGACACCGTGGCCTACATCATA TTCACGTCTGGATCAACCGGCACACCCAAAGGAGTCGTCGTGACGCACTCAGCAGCGACTGCGGGCATGGCCTGC CATAATCTCCATGGACTGTCCCGCTGGTTGCTCTTCTTCAACCCGGTCTTCTCTGCCGCACAGCGAACAATGCTC TCGACCCTTGTGCATGGGGCTCTGCTACTTCTCGCGAGTAAAGAGCGGCTCGCGAGCAACTTGTCGTCGCTCGTG AGGGAAATGAACGTCGATGCACTTGGCATTACGCCCTCGGCCCTGAGTGCCCTTCGACCCGACGCCATCCCCTCC GTCAAGCGCATAACTCTGGTTGGCGAGAGAATTCCCCAAGAGATTGTCAACGCATGGGCCGACAAGGTCGTGCTG TGCAACAGCTACGGCTTGAGCGAATGCACACAAATCAACTTCAGCCAACGACTAAGCCCGGGCTCCAATCCTCGG ATTGTGGGCAGGCCTATAGACACCACGACTGCCTATGTTATGGAGCCTTCGTCACTCAACCTGGCGCCCGTGGGC ACACAAGGAGAACTCTGCCTGACAGGAGCCCAATTGGCTCAAGGCTATCTGGGCCTTCCAGAAGAGACCGCTCGC GTCTTCATCCCCAACCCGTTCGGCCACGGCCGCATGTACCGAACTGGCGATGTCGCCAAGACGCACCCAGATGGC TCCATCGAGATTGTCGGCCGAATCGACTTTCAGGCCAAGATTGGAGGACAAAAAGTCGACCCGTCAGAGGTAGAC GAGGTGGTCGTTAAGCACCCTGCTGTTATTCGTTGTGCTGAGCAAGACTGA |
| Transcript | >Hirsu2|6278 ATGGCAATCGTCGCTCACGTTCCCAACCCTTCTCCGTACCGCGCGGTCACAAGTTCACTCTTGACGAAGCCGCTG ACCCTGACGTACGATGTCGACACACGCTATGACATTGAGACGAGACGCATTTCCCGTGATCCTCACAAGGATGTC CGCCACGTCCAGCCGACAACTATAAGTCGTCTCTTCGAAAACACAGTCCTCAGAAACCCAGCCAGGCCGGCCGTT CAGTACGAAAATGATGAACCCGTCACGTTTGGCCAGCTCAATACCGCGTCAAACAAGCTTGCTCGGACGCTGAAG CTCAAGCCCGGATCGATTGTCCCCGTCTGCCTGGACCGCTCCGTTGATCTCATCATATCCTTGCTGGCCATCCTC AAGTCAGGGGCAGCATACACCATACTTGATCCCGATGCTCCGTCTCGGCGAGCCCAGGCCATCATCGAGACTTGC AATGCCACCCAAATCCTAGTGCAGCGCAAGCATGCCAGCCGCTTCAGCTGCCCGACCTGGGTGATGGAAGATGTC GCTAGCGAATCTATACAGCAGGACGGCTCCAACCTGAGCCTTAAGGTTTCGCCAGACACCGTGGCCTACATCATA TTCACGTCTGGATCAACCGGCACACCCAAAGGAGTCGTCGTGACGCACTCAGCAGCGACTGCGGGCATGGCCTGC CATAATCTCCATGGACTGTCCCGCTGGTTGCTCTTCTTCAACCCGGTCTTCTCTGCCGCACAGCGAACAATGCTC TCGACCCTTGTGCATGGGGCTCTGCTACTTCTCGCGAGTAAAGAGCGGCTCGCGAGCAACTTGTCGTCGCTCGTG AGGGAAATGAACGTCGATGCACTTGGCATTACGCCCTCGGCCCTGAGTGCCCTTCGACCCGACGCCATCCCCTCC GTCAAGCGCATAACTCTGGTTGGCGAGAGAATTCCCCAAGAGATTGTCAACGCATGGGCCGACAAGGTCGTGCTG TGCAACAGCTACGGCTTGAGCGAATGCACACAAATCAACTTCAGCCAACGACTAAGCCCGGGCTCCAATCCTCGG ATTGTGGGCAGGCCTATAGACACCACGACTGCCTATGTTATGGAGCCTTCGTCACTCAACCTGGCGCCCGTGGGC ACACAAGGAGAACTCTGCCTGACAGGAGCCCAATTGGCTCAAGGCTATCTGGGCCTTCCAGAAGAGACCGCTCGC GTCTTCATCCCCAACCCGTTCGGCCACGGCCGCATGTACCGAACTGGCGATGTCGCCAAGACGCACCCAGATGGC TCCATCGAGATTGTCGGCCGAATCGACTTTCAGGCCAAGATTGGAGGACAAAAAGTCGACCCGTCAGAGGTAGAC GAGGTGGTCGTTAAGCACCCTGCTGTTATTCGTTGTGCTGAGCAAGACTGA |
| Gene | >Hirsu2|6278 ATGGCAATCGTCGCTCACGTTCCCAACCCTTCTCCGTACCGCGCGGTCACAAGTTCACTCTTGACGAAGCCGCTG ACCCTGACGTACGATGTCGACACACGCTATGACATTGAGACGAGACGCATTTCCCGTGATCCTCACAAGGATGTC CGCCACGTCCAGCCGACAACTATAAGTCGTCTCTTCGAAAACACAGTCCTCAGAAACCCAGCCAGGCCGGCCGTT CAGTACGAAAATGATGAACCCGTCACGTTTGGCCAGCTCAATACCGCGTCAAACAAGCTTGCTCGGACGCTGAAG CTCAAGCCCGGATCGATTGTCCCCGTCTGCCTGGACCGCTCCGTTGATCTCATCATATCCTTGCTGGCCATCCTC AAGTCAGGGGCAGCATACACCATACTTGATCCCGATGCTCCGTCTCGGCGAGCCCAGGCCATCATCGAGACTTGC AATGCCACCCAAATCCTAGTGCAGCGCAAGCATGCCAGCCGCTTCAGCTGCCCGACCTGGGTGATGGAAGATGTC GCTAGCGAATCTATACAGCAGGACGGCTCCAACCTGAGCCTTAAGGTTTCGCCAGACACCGTGGCCTACATCATA TTCACGTCTGGATCAACCGGCACACCCAAAGGAGTCGTCGTGACGCACTCAGCAGCGACTGCGGGCATGGCCTGC CATAATCTCCATGGACTGTCCCGCTGGTTGCTCTTCTTCAACCCGGTCTTCTCTGCCGCACAGCGAACAATGCTC TCGACCCTTGTGCATGGGGCTCTGCTACTTCTCGCGAGTAAAGAGCGGCTCGCGAGCAACTTGTCGTCGCTCGTG AGGGAAATGAACGTCGATGCACTTGGCATTACGCCCTCGGCCCTGAGTGCCCTTCGACCCGACGCCATCCCCTCC GTCAAGCGCATAACTCTGGTTGGCGAGAGAATTCCCCAAGAGATTGTCAACGCATGGGCCGACAAGGTCGTGCTG TGCAACAGCTACGGCTTGAGCGAATGCACACAAATCAACTTCAGCCAACGACTAAGCCCGGGCTCCAATCCTCGG ATTGTGGGCAGGCCTATAGACACCACGACTGCCTATGTTATGGAGCCTTCGTCACTCAACCTGGCGCCCGTGGGC ACACAAGGAGAACTCTGCCTGACAGGAGCCCAATTGGCTCAAGGCTATCTGGGCCTTCCAGAAGAGACCGCTCGC GTCTTCATCCCCAACCCGTTCGGCCACGGCCGCATGTACCGAACTGGCGATGTCGCCAAGACGCACCCAGATGGC TCCATCGAGATTGTCGGCCGAATCGACTTTCAGGCCAAGATTGGAGGACAAAAAGTCGACCCGTCAGAGGTAGAC GAGGTGGTCGTTAAGCACCCTGCTGTTATTCGGTGTGCCACAGTACCCGTTGACCTCTCGGATGGGGATGGATTC GTGACCCTCGTTACGGCAGTTGTGCTGAGCAAGACTGA |