Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6259
Gene name
LocationContig_319:22669..23717
Strand-
Gene length (bp)1048
Transcript length (bp)897
Coding sequence length (bp)897
Protein length (aa) 299

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00891 Methyltransf_2 O-methyltransferase domain 5.1E-17 128 273

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 1 283 2.0E-34
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 1 283 1.0E-32
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 9 282 7.0E-21
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 9 282 4.0E-19
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 59 278 6.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P900|OMTB_ASPFL Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus flavus GN=omtB PE=3 SV=1 1 283 2.0E-34
sp|Q9UQY0|OMTB_ASPPA Demethylsterigmatocystin 6-O-methyltransferase OS=Aspergillus parasiticus GN=omtB PE=1 SV=2 1 283 1.0E-32
sp|Q12120|OMTA_ASPPA Sterigmatocystin 8-O-methyltransferase OS=Aspergillus parasiticus GN=omtA PE=1 SV=1 9 282 7.0E-21
sp|P55790|OMTA_ASPFL Sterigmatocystin 8-O-methyltransferase OS=Aspergillus flavus GN=omtA PE=3 SV=1 9 282 4.0E-19
sp|P93324|CHOMT_MEDSA Isoliquiritigenin 2'-O-methyltransferase OS=Medicago sativa PE=1 SV=1 59 278 6.0E-15
sp|A1DA61|FTMD_NEOFI 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ftmMT PE=3 SV=1 65 289 2.0E-13
sp|Q4WAW6|FTMD_ASPFU 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ftmMT PE=1 SV=1 65 289 1.0E-12
sp|A8QW52|OMT1_SORBI Eugenol O-methyltransferase OS=Sorghum bicolor GN=EOMT PE=1 SV=1 56 273 6.0E-12
sp|B9WZX2|FTMD_ASPFM 6-hydroxytryprostatin B O-methyltransferase OS=Neosartorya fumigata GN=ftmMT PE=1 SV=1 65 289 8.0E-12
sp|Q9LEL5|4OMT_COPJA 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase OS=Coptis japonica PE=1 SV=1 129 278 1.0E-11
sp|P42712|DMPM_STRAD O-demethylpuromycin-O-methyltransferase OS=Streptomyces alboniger GN=dmpM PE=3 SV=1 129 278 2.0E-11
sp|Q9FK25|OMT1_ARATH Flavone 3'-O-methyltransferase 1 OS=Arabidopsis thaliana GN=OMT1 PE=1 SV=1 56 286 2.0E-11
sp|Q7XB10|4OMT2_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 2 OS=Papaver somniferum GN=4'OMT2 PE=1 SV=1 129 273 1.0E-10
sp|C7SDN9|N7OMT_PAPSO Norreticuline-7-O-methyltransferase OS=Papaver somniferum PE=1 SV=1 129 273 3.0E-10
sp|O22308|7OMT6_MEDSA Isoflavone-7-O-methyltransferase 6 OS=Medicago sativa PE=2 SV=1 77 274 8.0E-10
sp|O22309|7OMT9_MEDSA Isoflavone-7-O-methyltransferase 9 OS=Medicago sativa PE=2 SV=1 77 274 8.0E-10
sp|B8RCD3|AIMT1_PIMAN Trans-anol O-methyltransferase 1 OS=Pimpinella anisum GN=AIMT1 PE=1 SV=1 69 273 2.0E-09
sp|Q7XB11|4OMT1_PAPSO 3'-hydroxy-N-methyl-(S)-coclaurine 4'-O-methyltransferase 1 OS=Papaver somniferum GN=4'OMT1 PE=2 SV=1 129 273 2.0E-09
sp|O24529|7OMT8_MEDSA Isoflavone-7-O-methyltransferase 8 OS=Medicago sativa PE=1 SV=1 77 274 3.0E-09
sp|Q39522|SMT_COPJA (S)-scoulerine 9-O-methyltransferase OS=Coptis japonica GN=SMT PE=1 SV=1 129 288 4.0E-09
sp|Q6T1F6|BMT_AMMMJ Bergaptol O-methyltransferase OS=Ammi majus GN=BMT PE=1 SV=1 129 274 8.0E-09
sp|Q43239|COMT1_ZINVI Caffeic acid 3-O-methyltransferase OS=Zinnia violacea PE=2 SV=1 73 274 9.0E-09
sp|Q9FQY8|COMT1_CAPAN Caffeic acid 3-O-methyltransferase OS=Capsicum annuum GN=COMT PE=2 SV=2 56 273 1.0E-08
sp|Q54B59|OMT12_DICDI O-methyltransferase 12 OS=Dictyostelium discoideum GN=omt12 PE=1 SV=1 88 278 1.0E-08
sp|Q8T638|DMTA_DICDI Des-methyl DIF-1 methyltransferase A OS=Dictyostelium discoideum GN=dmtA PE=1 SV=1 129 275 2.0E-08
sp|Q84KK5|D7OMT_GLYEC Isoflavone 7-O-methyltransferase OS=Glycyrrhiza echinata GN=D7OMT PE=1 SV=1 129 279 2.0E-08
sp|B0CN39|SFMM3_STRLA O-methyltransferase SfmM3 OS=Streptomyces lavendulae GN=sfmM3 PE=3 SV=1 127 292 2.0E-08
sp|Q54FP4|OMT10_DICDI O-methyltransferase 10 OS=Dictyostelium discoideum GN=omt10 PE=3 SV=2 181 280 3.0E-08
sp|P46484|COMT1_EUCGU Caffeic acid 3-O-methyltransferase OS=Eucalyptus gunnii GN=OMT PE=2 SV=1 129 288 5.0E-08
sp|Q9XGW0|COMT1_OCIBA Caffeic acid 3-O-methyltransferase 1 OS=Ocimum basilicum GN=COMT1 PE=2 SV=1 94 289 7.0E-08
sp|Q9XGV9|COMT2_OCIBA Caffeic acid 3-O-methyltransferase 2 OS=Ocimum basilicum GN=COMT2 PE=2 SV=1 56 274 1.0E-07
sp|P46597|ASMT_HUMAN Acetylserotonin O-methyltransferase OS=Homo sapiens GN=ASMT PE=1 SV=1 127 289 2.0E-07
sp|Q38J50|FOMT2_WHEAT Tricetin 3',4',5'-O-trimethyltransferase OS=Triticum aestivum GN=OMT2 PE=1 SV=1 94 278 2.0E-07
sp|O81646|COMT1_CAPCH Caffeic acid 3-O-methyltransferase OS=Capsicum chinense GN=COMT PE=2 SV=1 129 267 2.0E-07
sp|Q06509|COMT1_MAIZE Caffeic acid 3-O-methyltransferase OS=Zea mays PE=3 SV=1 73 273 2.0E-07
sp|Q8HZJ0|ASMT_MACMU Acetylserotonin O-methyltransferase OS=Macaca mulatta GN=ASMT PE=2 SV=1 127 289 2.0E-07
sp|Q6WUC1|6OMT_PAPSO (RS)-norcoclaurine 6-O-methyltransferase OS=Papaver somniferum GN=6OMT PE=1 SV=1 129 273 2.0E-07
sp|P16559|TCMN_STRGA Multifunctional cyclase-dehydratase-3-O-methyl transferase TcmN OS=Streptomyces glaucescens GN=tcmN PE=1 SV=2 77 278 3.0E-07
sp|B3GSH5|ASMT_RAT Acetylserotonin O-methyltransferase OS=Rattus norvegicus GN=Asmt PE=1 SV=1 129 297 1.0E-06
sp|Q43046|COMT1_POPKI Caffeic acid 3-O-methyltransferase 1 OS=Populus kitakamiensis GN=HOMT1 PE=3 SV=1 94 278 1.0E-06
sp|P10950|ASMT_BOVIN Acetylserotonin O-methyltransferase OS=Bos taurus GN=ASMT PE=1 SV=2 127 289 1.0E-06
sp|O95671|ASML_HUMAN N-acetylserotonin O-methyltransferase-like protein OS=Homo sapiens GN=ASMTL PE=1 SV=3 183 293 3.0E-06
sp|Q00763|COMT1_POPTM Caffeic acid 3-O-methyltransferase 1 OS=Populus tremuloides GN=OMT1 PE=1 SV=1 94 278 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008171 O-methyltransferase activity Yes
GO:0008168 methyltransferase activity No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.4973 0.5573 0.0467 0.0374 0.1334 0.0102 0.0767 0.152 0.1336 0.0504

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup30
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7767
Ophiocordyceps australis 1348a (Ghana) OphauG2|7346
Ophiocordyceps australis 1348a (Ghana) OphauG2|7110
Ophiocordyceps australis 1348a (Ghana) OphauG2|4885
Ophiocordyceps australis 1348a (Ghana) OphauG2|4306
Ophiocordyceps australis 1348a (Ghana) OphauG2|3956
Ophiocordyceps australis 1348a (Ghana) OphauG2|1539
Ophiocordyceps australis 1348a (Ghana) OphauG2|1895
Ophiocordyceps australis 1348a (Ghana) OphauG2|266
Ophiocordyceps australis map64 (Brazil) OphauB2|758
Ophiocordyceps australis map64 (Brazil) OphauB2|1462
Ophiocordyceps australis map64 (Brazil) OphauB2|2012
Ophiocordyceps australis map64 (Brazil) OphauB2|4017
Ophiocordyceps australis map64 (Brazil) OphauB2|4564
Ophiocordyceps australis map64 (Brazil) OphauB2|7299
Ophiocordyceps camponoti-rufipedis Ophun1|2861
Ophiocordyceps camponoti-rufipedis Ophun1|2000
Ophiocordyceps subramaniannii Hirsu2|8115
Ophiocordyceps subramaniannii Hirsu2|7926
Ophiocordyceps subramaniannii Hirsu2|6259 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2878
Ophiocordyceps subramaniannii Hirsu2|1201
Ophiocordyceps subramaniannii Hirsu2|11082

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6259
MRMLVAVGIGRETAPDEYAHNALSRRFHPMAWGGVARMYVEYARVMAMMPDYLRAHRPDDILDLRKSPFAFAAGL
EGKTYYEMLDLDLEDRDVWNRVFHNMAKNYPFRDMFPFRALEQQVRRQPDRPFIVDVGGGRGQSLQAIRDTCGGS
FGSKLILQDLPAVIDSLRPEDLSGIEPMAHDAFTPQPVKNAHVYLLRRLLHDFYDPEAVEILKRTASAMGPDSRL
VICELLLPERVQTGASLLPYWTDICLMMIGGQERSLSGYEAIIRDAGLELVQVYRSKDGHNAMIETRLPQPAS*
Coding >Hirsu2|6259
ATGCGCATGCTCGTCGCCGTCGGCATCGGCCGCGAGACGGCGCCCGACGAGTACGCCCACAACGCCCTGTCGCGC
CGCTTCCACCCGATGGCCTGGGGCGGCGTCGCCCGCATGTACGTCGAGTACGCCCGCGTCATGGCCATGATGCCC
GACTACCTCCGCGCCCACCGGCCCGACGACATCCTCGACCTGCGCAAGAGCCCGTTTGCCTTCGCCGCCGGCCTC
GAGGGCAAGACGTACTACGAGATGCTCGACCTCGACCTCGAGGACCGCGACGTCTGGAACCGCGTCTTCCACAAC
ATGGCCAAGAACTATCCCTTCCGGGACATGTTCCCCTTCCGCGCCCTCGAGCAGCAGGTCCGCCGCCAGCCGGAC
CGGCCCTTCATCGTCGACGTCGGCGGTGGGAGGGGACAGTCGCTGCAGGCGATCCGCGACACGTGCGGAGGCTCC
TTCGGCAGCAAGCTGATCCTCCAAGACTTGCCGGCCGTCATCGACTCTCTCCGTCCCGAGGACCTTTCCGGAATC
GAGCCAATGGCGCACGATGCCTTTACGCCCCAGCCAGTCAAGAACGCCCATGTCTACCTCCTGCGTCGGCTCTTG
CACGACTTTTACGATCCCGAGGCCGTCGAGATCCTCAAGCGCACGGCCTCGGCCATGGGACCCGACTCGCGACTC
GTCATCTGCGAGTTGCTGCTGCCGGAACGCGTCCAGACTGGTGCCTCGCTGCTGCCGTACTGGACCGACATCTGC
CTGATGATGATCGGCGGCCAGGAGCGCTCGCTGTCTGGCTACGAGGCCATCATCCGTGACGCCGGCTTGGAGCTG
GTCCAGGTGTACCGGTCCAAGGATGGGCACAACGCCATGATCGAGACTCGTCTCCCGCAGCCAGCATCGTAG
Transcript >Hirsu2|6259
ATGCGCATGCTCGTCGCCGTCGGCATCGGCCGCGAGACGGCGCCCGACGAGTACGCCCACAACGCCCTGTCGCGC
CGCTTCCACCCGATGGCCTGGGGCGGCGTCGCCCGCATGTACGTCGAGTACGCCCGCGTCATGGCCATGATGCCC
GACTACCTCCGCGCCCACCGGCCCGACGACATCCTCGACCTGCGCAAGAGCCCGTTTGCCTTCGCCGCCGGCCTC
GAGGGCAAGACGTACTACGAGATGCTCGACCTCGACCTCGAGGACCGCGACGTCTGGAACCGCGTCTTCCACAAC
ATGGCCAAGAACTATCCCTTCCGGGACATGTTCCCCTTCCGCGCCCTCGAGCAGCAGGTCCGCCGCCAGCCGGAC
CGGCCCTTCATCGTCGACGTCGGCGGTGGGAGGGGACAGTCGCTGCAGGCGATCCGCGACACGTGCGGAGGCTCC
TTCGGCAGCAAGCTGATCCTCCAAGACTTGCCGGCCGTCATCGACTCTCTCCGTCCCGAGGACCTTTCCGGAATC
GAGCCAATGGCGCACGATGCCTTTACGCCCCAGCCAGTCAAGAACGCCCATGTCTACCTCCTGCGTCGGCTCTTG
CACGACTTTTACGATCCCGAGGCCGTCGAGATCCTCAAGCGCACGGCCTCGGCCATGGGACCCGACTCGCGACTC
GTCATCTGCGAGTTGCTGCTGCCGGAACGCGTCCAGACTGGTGCCTCGCTGCTGCCGTACTGGACCGACATCTGC
CTGATGATGATCGGCGGCCAGGAGCGCTCGCTGTCTGGCTACGAGGCCATCATCCGTGACGCCGGCTTGGAGCTG
GTCCAGGTGTACCGGTCCAAGGATGGGCACAACGCCATGATCGAGACTCGTCTCCCGCAGCCAGCATCGTAG
Gene >Hirsu2|6259
ATGCGCATGCTCGTCGCCGTCGGCATCGGCCGCGAGACGGCGCCCGACGAGTACGCCCACAACGCCCTGTCGCGC
CGCTTCCACCCGATGGCCTGGGGCGGCGTCGCCCGCATGTACGTCGAGTACGCCCGCGTCATGGCCATGATGCCC
GACTACCTCCGCGCCCACCGGCCCGACGACATCCTCGACCTGCGCAAGAGCCCGTTTGCCTTCGCCGCCGGCCTC
GAGGGCAAGACGTACTACGAGATGCTCGACCTCGACCTCGAGGACCGCGACGTCTGGAACCGCGTCTTCCACAAC
ATGGCCAAGAACTATCCCTTCCGGGACATGTTCCCCTTCCGCGCCCTCGAGCAGCAGGTCCGCCGCCAGCCGGAC
CGGCCCTTCATCGTCGACGTCGGCGGTGGGAGGGGACAGTCGCTGCAGGCGATCCGCGACACGTGCGGAGGCTCC
TTCGGCAGCAAGCTGATCCTCCAAGACTTGCCGGCCGTCATCGACTCTCTCCGTCCCGAGGACCTTTCCGGAATC
GAGCCAATGGCGCACGATGCCTTTACGCCCCAGCCAGTCAAGAGTCAGTGTCACTCACCCCCGTCCTCTCACCCT
CCCTGCACAGGCCCTACCCCTTACCCGAACCGTATATCCATACATACAAACGAGTCACGTCTGACGGGCATAAAA
TATATGGATTCGACATCCGGCGGGAGGGGGGAAAAAAAAAATAGACGCCCATGTCTACCTCCTGCGTCGGCTCTT
GCACGACTTTTACGATCCCGAGGCCGTCGAGATCCTCAAGCGCACGGCCTCGGCCATGGGACCCGACTCGCGACT
CGTCATCTGCGAGTTGCTGCTGCCGGAACGCGTCCAGACTGGTGCCTCGCTGCTGCCGTACTGGACCGACATCTG
CCTGATGATGATCGGCGGCCAGGAGCGCTCGCTGTCTGGCTACGAGGCCATCATCCGTGACGCCGGCTTGGAGCT
GGTCCAGGTGTACCGGTCCAAGGATGGGCACAACGCCATGATCGAGACTCGTCTCCCGCAGCCAGCATCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail