Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6237
Gene name
LocationContig_318:2778..5040
Strand+
Gene length (bp)2262
Transcript length (bp)2262
Coding sequence length (bp)2262
Protein length (aa) 754

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00004 AAA ATPase family associated with various cellular activities (AAA) 2.8E-12 222 350
PF00004 AAA ATPase family associated with various cellular activities (AAA) 4.9E-44 524 652
PF07728 AAA_5 AAA domain (dynein-related subfamily) 1.4E-04 523 634
PF07724 AAA_2 AAA domain (Cdc48 subfamily) 1.2E-04 523 618
PF05496 RuvB_N Holliday junction DNA helicase RuvB P-loop domain 1.7E-04 523 591

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 29 750 5.0E-128
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 128 714 1.0E-116
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 188 750 3.0E-111
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 167 749 3.0E-108
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 188 750 5.0E-99
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14325|YB7A_SCHPO Uncharacterized AAA domain-containing protein C16E9.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16E9.10c PE=1 SV=1 29 750 5.0E-128
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 128 714 1.0E-116
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 188 750 3.0E-111
sp|Q9DBY8|NVL_MOUSE Nuclear valosin-containing protein-like OS=Mus musculus GN=Nvl PE=1 SV=1 167 749 3.0E-108
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 188 750 5.0E-99
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 207 717 3.0E-88
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 207 708 4.0E-87
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 207 717 5.0E-87
sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 188 716 9.0E-87
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 207 717 9.0E-87
sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 207 714 2.0E-86
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 207 711 3.0E-86
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 207 711 3.0E-86
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 207 711 3.0E-86
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 207 711 3.0E-86
sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 207 714 5.0E-86
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 207 711 6.0E-86
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 207 717 8.0E-86
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 204 719 8.0E-86
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 207 717 1.0E-85
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 207 744 3.0E-85
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 207 718 4.0E-85
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 207 718 9.0E-85
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 207 717 1.0E-84
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 207 744 2.0E-83
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 207 752 4.0E-83
sp|O05209|VAT_THEAC VCP-like ATPase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=vat PE=1 SV=1 148 752 7.0E-83
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 207 713 4.0E-82
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 209 717 7.0E-81
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 207 717 3.0E-80
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 207 717 8.0E-80
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 166 718 1.0E-76
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 204 718 1.0E-70
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 204 718 1.0E-69
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 206 742 3.0E-68
sp|P24004|PEX1_YEAST Peroxisomal ATPase PEX1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX1 PE=1 SV=2 174 737 1.0E-65
sp|P46463|PEX1_PICPA Peroxisome biosynthesis protein PAS1 OS=Komagataella pastoris GN=PEX1 PE=3 SV=1 214 716 1.0E-64
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 462 713 2.0E-61
sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 218 749 1.0E-59
sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2 183 714 5.0E-59
sp|Q99LC9|PEX6_MOUSE Peroxisome assembly factor 2 OS=Mus musculus GN=Pex6 PE=1 SV=1 166 714 4.0E-58
sp|Q54CS8|PEX6_DICDI Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1 221 722 4.0E-58
sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1 220 720 6.0E-58
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 218 714 1.0E-57
sp|Q54GX5|PEX1_DICDI Peroxisome biogenesis factor 1 OS=Dictyostelium discoideum GN=pex1 PE=3 SV=1 475 716 1.0E-57
sp|Q9ZPR1|CD48B_ARATH Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 204 718 2.0E-57
sp|P36966|PEX6_YARLI Peroxisomal biogenesis factor 6 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX6 PE=3 SV=2 212 714 6.0E-56
sp|Q8RY16|PEX6_ARATH Peroxisome biogenesis protein 6 OS=Arabidopsis thaliana GN=PEX6 PE=1 SV=1 222 718 7.0E-56
sp|P54777|PEX6_RAT Peroxisome assembly factor 2 OS=Rattus norvegicus GN=Pex6 PE=1 SV=1 180 714 1.0E-55
sp|Q9FNP1|PEX1_ARATH Peroxisome biogenesis protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=2 322 716 2.0E-55
sp|Q9UVU5|PEX6_PICAN Peroxisomal biogenesis factor 6 OS=Pichia angusta GN=PEX6 PE=1 SV=1 229 714 3.0E-55
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 442 717 6.0E-55
sp|Q9C1E9|PEX6_COLOR Peroxisomal biogenesis factor 6 OS=Colletotrichum orbiculare (strain 104-T / ATCC 96160 / CBS 514.97 / LARS 414 / MAFF 240422) GN=PEX6 PE=3 SV=2 215 714 2.0E-54
sp|Q5BL07|PEX1_MOUSE Peroxisome biogenesis factor 1 OS=Mus musculus GN=Pex1 PE=1 SV=2 461 713 2.0E-54
sp|Q9HG03|PEX6_PENCH Peroxisomal biogenesis factor 6 OS=Penicillium chrysogenum GN=pex6 PE=3 SV=1 326 714 2.0E-52
sp|Q7SGP2|PEX6_NEUCR Peroxisomal biogenesis factor 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pex-6 PE=3 SV=1 263 707 2.0E-52
sp|Q6CPV1|PEX6_KLULA Peroxisomal biogenesis factor 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX6 PE=3 SV=1 481 737 2.0E-52
sp|O13764|PEX6_SCHPO Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex6 PE=3 SV=1 221 714 8.0E-52
sp|P33760|PEX6_YEAST Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX6 PE=1 SV=1 481 714 2.0E-51
sp|O74941|PEX1_SCHPO Peroxisomal ATPase pex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex1 PE=3 SV=1 465 717 2.0E-51
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 455 716 6.0E-50
sp|Q74Z13|PEX6_ASHGO Peroxisomal biogenesis factor 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX6 PE=3 SV=1 229 714 2.0E-49
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 475 717 1.0E-48
sp|Q6FW67|PEX6_CANGA Peroxisomal biogenesis factor 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PEX6 PE=3 SV=1 481 714 4.0E-48
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 481 716 5.0E-48
sp|C3PGA0|ARC_CORA7 AAA ATPase forming ring-shaped complexes OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=arc PE=3 SV=1 481 740 8.0E-48
sp|Q8NQD8|ARC_CORGL AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=arc PE=3 SV=1 482 664 4.0E-46
sp|A4QE83|ARC_CORGB AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain R) GN=arc PE=3 SV=1 482 664 4.0E-46
sp|Q8TX03|PAN_METKA Proteasome-activating nucleotidase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pan PE=3 SV=1 482 714 5.0E-46
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 484 741 7.0E-46
sp|D0LDS6|ARC_GORB4 Proteasome-associated ATPase OS=Gordonia bronchialis (strain ATCC 25592 / DSM 43247 / JCM 3198 / NCTC 10667) GN=arc PE=3 SV=1 417 664 9.0E-46
sp|A4TB65|ARC_MYCGI Proteasome-associated ATPase OS=Mycobacterium gilvum (strain PYR-GCK) GN=mpa PE=3 SV=1 481 664 1.0E-45
sp|Q6NH92|ARC_CORDI AAA ATPase forming ring-shaped complexes OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=arc PE=3 SV=1 481 655 1.0E-45
sp|Q1B795|ARC_MYCSS Proteasome-associated ATPase OS=Mycobacterium sp. (strain MCS) GN=mpa PE=3 SV=1 481 664 1.0E-45
sp|A1UHT0|ARC_MYCSK Proteasome-associated ATPase OS=Mycobacterium sp. (strain KMS) GN=mpa PE=3 SV=1 481 664 1.0E-45
sp|A3Q196|ARC_MYCSJ Proteasome-associated ATPase OS=Mycobacterium sp. (strain JLS) GN=mpa PE=3 SV=1 481 664 1.0E-45
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 471 717 2.0E-45
sp|Q5JHS5|PAN_THEKO Proteasome-activating nucleotidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pan PE=3 SV=1 465 713 2.0E-45
sp|A0QZ54|ARC_MYCS2 Proteasome-associated ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mpa PE=1 SV=1 481 664 2.0E-45
sp|A1TAQ3|ARC_MYCVP Proteasome-associated ATPase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mpa PE=3 SV=1 481 664 3.0E-45
sp|C1ASQ2|ARC_RHOOB Proteasome-associated ATPase OS=Rhodococcus opacus (strain B4) GN=arc PE=3 SV=1 481 664 3.0E-45
sp|B1VDV2|ARC_CORU7 AAA ATPase forming ring-shaped complexes OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=arc PE=3 SV=1 481 664 3.0E-45
sp|Q0SIF4|ARC_RHOJR Proteasome-associated ATPase OS=Rhodococcus jostii (strain RHA1) GN=arc PE=3 SV=1 481 664 4.0E-45
sp|C8XAR0|ARC_NAKMY Proteasome-associated ATPase OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=arc PE=3 SV=1 481 664 4.0E-45
sp|Q6BS73|PEX6_DEBHA Peroxisomal biogenesis factor 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX6 PE=3 SV=2 228 714 4.0E-45
sp|A0QFB2|ARC_MYCA1 Proteasome-associated ATPase OS=Mycobacterium avium (strain 104) GN=mpa PE=3 SV=2 481 664 4.0E-45
sp|B2HFW2|ARC_MYCMM Proteasome-associated ATPase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=mpa PE=3 SV=1 481 663 5.0E-45
sp|A0PQT9|ARC_MYCUA Proteasome-associated ATPase OS=Mycobacterium ulcerans (strain Agy99) GN=mpa PE=3 SV=1 481 663 5.0E-45
sp|O57940|PAN_PYRHO Proteasome-activating nucleotidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pan PE=3 SV=1 477 714 5.0E-45
sp|Q9YAC7|PAN_AERPE Proteasome-activating nucleotidase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pan PE=3 SV=1 482 742 6.0E-45
sp|Q8FTE3|ARC_COREF AAA ATPase forming ring-shaped complexes OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=arc PE=3 SV=1 482 664 6.0E-45
sp|O50202|ARC_RHOER Proteasome-associated ATPase OS=Rhodococcus erythropolis GN=arc PE=1 SV=1 481 664 6.0E-45
sp|C0ZZV2|ARC_RHOE4 Proteasome-associated ATPase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=arc PE=3 SV=1 481 664 6.0E-45
sp|D1A2S5|ARC_THECD Proteasome-associated ATPase OS=Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NCIMB 10081) GN=arc PE=3 SV=1 482 664 7.0E-45
sp|B1MAH2|ARC_MYCA9 Proteasome-associated ATPase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=mpa PE=3 SV=1 481 664 8.0E-45
sp|P46509|ARC_MYCLE Proteasome-associated ATPase OS=Mycobacterium leprae (strain TN) GN=mpa PE=3 SV=1 481 681 9.0E-45
sp|B8ZRF0|ARC_MYCLB Proteasome-associated ATPase OS=Mycobacterium leprae (strain Br4923) GN=mpa PE=3 SV=1 481 681 9.0E-45
sp|Q9C5U3|PRS8A_ARATH 26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=1 SV=1 481 738 1.0E-44
sp|Q5YUW4|ARC_NOCFA Proteasome-associated ATPase OS=Nocardia farcinica (strain IFM 10152) GN=arc PE=3 SV=1 481 664 1.0E-44
sp|Q9V287|PAN_PYRAB Proteasome-activating nucleotidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pan PE=3 SV=2 477 714 1.0E-44
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 471 717 2.0E-44
sp|P9WQN5|ARC_MYCTU Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mpa PE=1 SV=1 481 663 2.0E-44
sp|P9WQN4|ARC_MYCTO Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mpa PE=1 SV=1 481 663 2.0E-44
sp|C6DPU6|ARC_MYCTK Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain KZN 1435 / MDR) GN=mpa PE=3 SV=1 481 663 2.0E-44
sp|A5WP89|ARC_MYCTF Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain F11) GN=mpa PE=3 SV=1 481 663 2.0E-44
sp|A5U4E1|ARC_MYCTA Proteasome-associated ATPase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=mpa PE=3 SV=1 481 663 2.0E-44
sp|C1AQ31|ARC_MYCBT Proteasome-associated ATPase OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=mpa PE=3 SV=1 481 663 2.0E-44
sp|A1KKF8|ARC_MYCBP Proteasome-associated ATPase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=mpa PE=3 SV=1 481 663 2.0E-44
sp|P63346|ARC_MYCBO Proteasome-associated ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mpa PE=3 SV=1 481 663 2.0E-44
sp|A4FBX6|ARC_SACEN Proteasome-associated ATPase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=arc PE=3 SV=1 342 664 2.0E-44
sp|B8H8L3|ARC_ARTCA Proteasome-associated ATPase OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=arc PE=3 SV=1 481 664 2.0E-44
sp|O26824|PAN_METTH Proteasome-activating nucleotidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pan PE=3 SV=1 482 713 2.0E-44
sp|Q94BQ2|PRS8B_ARATH 26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=1 SV=1 481 738 2.0E-44
sp|A0JWY3|ARC_ARTS2 Proteasome-associated ATPase OS=Arthrobacter sp. (strain FB24) GN=arc PE=3 SV=1 481 664 2.0E-44
sp|Q5UT56|PAN2_HALVD Proteasome-activating nucleotidase 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan2 PE=2 SV=1 482 713 2.0E-44
sp|C4LIL2|ARC_CORK4 AAA ATPase forming ring-shaped complexes OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=arc PE=3 SV=2 481 655 2.0E-44
sp|Q4JVP5|ARC_CORJK AAA ATPase forming ring-shaped complexes OS=Corynebacterium jeikeium (strain K411) GN=arc PE=3 SV=1 481 655 3.0E-44
sp|A1R6Q4|ARC_ARTAT Proteasome-associated ATPase OS=Arthrobacter aurescens (strain TC1) GN=arc PE=3 SV=1 481 664 3.0E-44
sp|Q8SQK0|PRS8_ENCCU 26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT6 PE=1 SV=2 481 735 4.0E-44
sp|Q8U4H3|PAN_PYRFU Proteasome-activating nucleotidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pan PE=1 SV=1 477 714 4.0E-44
sp|A4G0S4|PAN_METM5 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1 482 717 4.0E-44
sp|C6WIC8|ARC_ACTMD Proteasome-associated ATPase OS=Actinosynnema mirum (strain ATCC 29888 / DSM 43827 / NBRC 14064 / IMRU 3971) GN=arc PE=3 SV=1 481 664 4.0E-44
sp|O64982|PRS7_PRUPE 26S protease regulatory subunit 7 OS=Prunus persica GN=RPT1 PE=2 SV=1 482 713 4.0E-44
sp|B1AI94|FTSH_UREP2 ATP-dependent zinc metalloprotease FtsH OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ftsH PE=3 SV=1 484 708 4.0E-44
sp|C5A6P8|PAN_THEGJ Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1 477 713 5.0E-44
sp|A1SK07|ARC_NOCSJ Proteasome-associated ATPase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=arc PE=3 SV=1 482 681 5.0E-44
sp|D2S6D9|ARC_GEOOG Proteasome-associated ATPase OS=Geodermatophilus obscurus (strain ATCC 25078 / DSM 43160 / JCM 3152 / G-20) GN=arc PE=3 SV=1 482 681 5.0E-44
sp|Q9SSB5|PRS7A_ARATH 26S protease regulatory subunit 7 homolog A OS=Arabidopsis thaliana GN=RPT1A PE=1 SV=1 482 713 6.0E-44
sp|A9A916|PAN_METM6 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1 482 717 8.0E-44
sp|Q41365|PRS7_SPIOL 26S protease regulatory subunit 7 OS=Spinacia oleracea GN=RPT1 PE=2 SV=1 482 713 9.0E-44
sp|Q9FXT9|PRS7_ORYSJ 26S protease regulatory subunit 7 OS=Oryza sativa subsp. japonica GN=RPT1A PE=2 SV=1 482 713 9.0E-44
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 473 718 1.0E-43
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 484 716 1.0E-43
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 471 717 1.0E-43
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 484 717 1.0E-43
sp|D2ATX1|ARC_STRRD Proteasome-associated ATPase OS=Streptosporangium roseum (strain ATCC 12428 / DSM 43021 / JCM 3005 / NI 9100) GN=arc PE=3 SV=1 482 664 1.0E-43
sp|C7MWW2|ARC_SACVD Proteasome-associated ATPase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) GN=arc PE=3 SV=1 481 664 1.0E-43
sp|A9WSI4|ARC_RENSM Proteasome-associated ATPase OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=arc PE=3 SV=1 481 671 1.0E-43
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 483 718 2.0E-43
sp|C7PVU9|ARC_CATAD Proteasome-associated ATPase OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=arc PE=3 SV=1 457 681 2.0E-43
sp|Q6LWR0|PAN_METMP Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain S2 / LL) GN=pan PE=3 SV=1 482 717 2.0E-43
sp|C5CBU4|ARC_MICLC AAA ATPase forming ring-shaped complexes OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=arc PE=3 SV=1 481 664 2.0E-43
sp|A8M2A0|ARC_SALAI Proteasome-associated ATPase OS=Salinispora arenicola (strain CNS-205) GN=arc PE=3 SV=1 482 687 2.0E-43
sp|A6VHR1|PAN_METM7 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1 482 717 2.0E-43
sp|B6YXR2|PAN_THEON Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1 477 713 3.0E-43
sp|Q0W257|PAN_METAR Proteasome-activating nucleotidase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pan PE=3 SV=1 482 738 3.0E-43
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 471 717 4.0E-43
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 471 717 5.0E-43
sp|C7MCZ0|ARC_BRAFD AAA ATPase forming ring-shaped complexes OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=arc PE=3 SV=1 481 656 5.0E-43
sp|Q01939|PRS8_YEAST 26S protease regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT6 PE=1 SV=4 481 738 5.0E-43
sp|D4GUJ7|PAN1_HALVD Proteasome-activating nucleotidase 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan1 PE=1 SV=2 482 713 5.0E-43
sp|Q67T82|FTSH2_SYMTH ATP-dependent zinc metalloprotease FtsH 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH2 PE=3 SV=1 484 714 6.0E-43
sp|A0LU46|ARC_ACIC1 Proteasome-associated ATPase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=arc PE=3 SV=1 482 664 8.0E-43
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 481 718 9.0E-43
sp|C9Z319|ARC_STRSW Proteasome-associated ATPase OS=Streptomyces scabiei (strain 87.22) GN=arc PE=3 SV=2 482 665 9.0E-43
sp|A4X741|ARC_SALTO Proteasome-associated ATPase OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=arc PE=3 SV=1 482 664 1.0E-42
sp|Q5R8D7|PRS7_PONAB 26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3 482 713 1.0E-42
sp|B1W303|ARC_STRGG Proteasome-associated ATPase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=arc PE=3 SV=1 482 664 1.0E-42
sp|P49825|FTSH_ODOSI ATP-dependent zinc metalloprotease FtsH OS=Odontella sinensis GN=ftsH PE=3 SV=1 450 708 1.0E-42
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 473 718 2.0E-42
sp|Q86JA1|PRS7_DICDI 26S protease regulatory subunit 7 OS=Dictyostelium discoideum GN=psmC2 PE=1 SV=1 482 713 2.0E-42
sp|O18413|PRS8_DROME 26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Rpt6 PE=1 SV=2 481 738 2.0E-42
sp|C7LYP4|ARC_ACIFD Proteasome-associated ATPase OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=arc PE=3 SV=1 436 655 2.0E-42
sp|P54814|PRS8_MANSE 26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1 481 738 2.0E-42
sp|A6W963|ARC_KINRD Proteasome-associated ATPase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=arc PE=3 SV=1 482 655 2.0E-42
sp|Q9RJ58|ARC_STRCO Proteasome-associated ATPase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=arc PE=3 SV=1 482 664 2.0E-42
sp|Q9SSB4|PRS7B_ARATH 26S protease regulatory subunit 7 homolog B OS=Arabidopsis thaliana GN=RPT1B PE=1 SV=2 482 712 2.0E-42
sp|D2Q4G5|ARC_KRIFD Proteasome-associated ATPase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) GN=arc PE=3 SV=1 482 694 2.0E-42
sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 484 737 3.0E-42
sp|A1A0U4|ARC_BIFAA AAA ATPase forming ring-shaped complexes OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=arc PE=3 SV=1 481 665 3.0E-42
sp|P46471|PRS7_MOUSE 26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5 482 713 3.0E-42
sp|Q4R4R0|PRS7_MACFA 26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3 482 713 3.0E-42
sp|P35998|PRS7_HUMAN 26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3 482 713 3.0E-42
sp|Q5E9F9|PRS7_BOVIN 26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3 482 713 3.0E-42
sp|Q828J2|ARC_STRAW Proteasome-associated ATPase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=arc PE=3 SV=1 482 664 4.0E-42
sp|Q0RLU1|ARC_FRAAA Proteasome-associated ATPase OS=Frankia alni (strain ACN14a) GN=arc PE=3 SV=2 482 664 4.0E-42
sp|P46472|PRS7_XENLA 26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1 482 713 5.0E-42
sp|Q63347|PRS7_RAT 26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3 482 713 5.0E-42
sp|P62198|PRS8_RAT 26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1 481 738 5.0E-42
sp|P62197|PRS8_PIG 26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1 481 738 5.0E-42
sp|P62196|PRS8_MOUSE 26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1 481 738 5.0E-42
sp|P62195|PRS8_HUMAN 26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1 481 738 5.0E-42
sp|P62194|PRS8_BOVIN 26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1 481 738 5.0E-42
sp|P33289|PEX6_PICPA Peroxisomal biogenesis factor 6 OS=Komagataella pastoris GN=PEX6 PE=3 SV=1 481 714 6.0E-42
sp|D2Q9C6|ARC_BIFDB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium dentium (strain ATCC 27534 / DSM 20436 / JCM 1195 / Bd1) GN=arc PE=3 SV=1 482 665 6.0E-42
sp|O28303|PAN_ARCFU Proteasome-activating nucleotidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pan PE=1 SV=1 477 714 7.0E-42
sp|Q47NX7|ARC_THEFY Proteasome-associated ATPase OS=Thermobifida fusca (strain YX) GN=arc PE=3 SV=1 482 664 8.0E-42
sp|Q8CDM1|ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 484 714 8.0E-42
sp|D3Q568|ARC_STANL Proteasome-associated ATPase OS=Stackebrandtia nassauensis (strain DSM 44728 / NRRL B-16338 / NBRC 102104 / LLR-40K-21) GN=arc PE=3 SV=1 482 664 9.0E-42
sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 484 714 1.0E-41
sp|O42931|PRS7_SCHPO 26S protease regulatory subunit 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt1 PE=1 SV=2 482 713 1.0E-41
sp|Q8YMZ8|FTSH_NOSS1 ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1 484 708 1.0E-41
sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 484 714 1.0E-41
sp|C6A7B2|ARC_BIFLB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain Bl-04 / DGCC2908 / RB 4825 / SD5219) GN=arc PE=3 SV=1 482 655 1.0E-41
sp|C6AHX0|ARC_BIFAS AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain DSM 10140 / JCM 10602 / LMG 18314) GN=arc PE=3 SV=1 482 655 1.0E-41
sp|B8DTX4|ARC_BIFA0 AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=arc PE=3 SV=1 482 655 1.0E-41
sp|D3R4I7|ARC_BIFAB AAA ATPase forming ring-shaped complexes OS=Bifidobacterium animalis subsp. lactis (strain BB-12) GN=arc PE=3 SV=1 482 655 1.0E-41
sp|A6UQT3|PAN_METVS Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1 482 735 1.0E-41
sp|D1BHU2|ARC_SANKS Proteasome-associated ATPase OS=Sanguibacter keddieii (strain ATCC 51767 / DSM 10542 / NCFB 3025 / ST-74) GN=arc PE=3 SV=1 481 681 1.0E-41
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 473 718 2.0E-41
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 484 716 2.0E-41
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 484 741 2.0E-41
sp|Q25544|PRS8_NAEFO 26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1 481 738 2.0E-41
sp|Q9SEI3|PS10A_ARATH 26S protease regulatory subunit 10B homolog A OS=Arabidopsis thaliana GN=RPT4A PE=1 SV=1 483 713 2.0E-41
sp|Q18787|PRS7_CAEEL 26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1 482 713 2.0E-41
sp|Q2J9Q0|ARC_FRASC Proteasome-associated ATPase OS=Frankia sp. (strain CcI3) GN=arc PE=3 SV=1 482 664 2.0E-41
sp|Q655S1|FTSH2_ORYSJ ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1 484 708 2.0E-41
sp|Q8SQI9|PRS6B_ENCCU 26S protease regulatory subunit 6B homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1970 PE=1 SV=1 482 749 2.0E-41
sp|P33298|PRS6B_YEAST 26S protease regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2 482 749 2.0E-41
sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 483 717 3.0E-41
sp|Q9HRW6|PAN1_HALSA Proteasome-activating nucleotidase 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan1 PE=3 SV=3 482 713 3.0E-41
sp|Q94392|NSF_CAEEL Vesicle-fusing ATPase OS=Caenorhabditis elegans GN=nsf-1 PE=1 SV=2 475 747 3.0E-41
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 483 717 4.0E-41
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 483 717 4.0E-41
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 483 717 4.0E-41
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 483 717 4.0E-41
sp|Q55700|FTSH2_SYNY3 ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH2 PE=1 SV=1 484 708 4.0E-41
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 483 717 5.0E-41
sp|O80860|FTSH2_ARATH ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1 468 708 5.0E-41
sp|P33299|PRS7_YEAST 26S protease regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT1 PE=1 SV=1 482 713 5.0E-41
sp|Q8TI88|PAN_METAC Proteasome-activating nucleotidase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pan PE=3 SV=2 483 714 6.0E-41
sp|C7R400|ARC_JONDD Proteasome-associated ATPase OS=Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) GN=arc PE=3 SV=1 482 664 6.0E-41
sp|D1BS23|ARC_XYLCX Proteasome-associated ATPase OS=Xylanimonas cellulosilytica (strain DSM 15894 / CECT 5975 / LMG 20990 / XIL07) GN=arc PE=3 SV=1 482 655 7.0E-41
sp|Q8W585|FTSH8_ARATH ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1 484 708 7.0E-41
sp|P40340|TBP7_YEAST Tat-binding homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA7 PE=1 SV=2 483 714 7.0E-41
sp|C3NFW6|PAN_SULIN Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pan PE=3 SV=1 482 713 7.0E-41
sp|Q10ZF7|FTSH_TRIEI ATP-dependent zinc metalloprotease FtsH OS=Trichodesmium erythraeum (strain IMS101) GN=ftsH PE=3 SV=1 484 708 7.0E-41
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 483 717 8.0E-41
sp|P73179|FTSH1_SYNY3 ATP-dependent zinc metalloprotease FtsH 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH1 PE=2 SV=1 435 708 8.0E-41
sp|C3N7K8|PAN_SULIY Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pan PE=3 SV=1 482 713 8.0E-41
sp|C3MY47|PAN_SULIM Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pan PE=3 SV=1 482 713 8.0E-41
sp|C3MRF1|PAN_SULIL Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pan PE=3 SV=1 482 713 8.0E-41
sp|C4KIR6|PAN_SULIK Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pan PE=3 SV=1 482 713 8.0E-41
sp|C3MZI6|PAN_SULIA Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.27) GN=pan PE=3 SV=1 482 713 8.0E-41
sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 483 717 1.0E-40
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 483 708 1.0E-40
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 471 717 2.0E-40
sp|Q2JNP0|FTSH_SYNJB ATP-dependent zinc metalloprotease FtsH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ftsH PE=3 SV=1 484 708 2.0E-40
sp|A8LH57|ARC_FRASN Proteasome-associated ATPase OS=Frankia sp. (strain EAN1pec) GN=arc PE=3 SV=1 482 664 2.0E-40
sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit 10B OS=Dictyostelium discoideum GN=psmC6 PE=1 SV=1 484 713 3.0E-40
sp|Q9TJ83|FTSH_CYAME ATP-dependent zinc metalloprotease FtsH OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1 453 714 3.0E-40
sp|P34124|PRS8_DICDI 26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2 481 713 3.0E-40
sp|Q9HNP9|PAN2_HALSA Proteasome-activating nucleotidase 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan2 PE=3 SV=1 482 713 4.0E-40
sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3 482 718 4.0E-40
sp|Q9QUL6|NSF_RAT Vesicle-fusing ATPase OS=Rattus norvegicus GN=Nsf PE=1 SV=1 482 718 4.0E-40
sp|P18708|NSF_CRIGR Vesicle-fusing ATPase OS=Cricetulus griseus GN=NSF PE=1 SV=1 482 718 4.0E-40
sp|P46460|NSF_MOUSE Vesicle-fusing ATPase OS=Mus musculus GN=Nsf PE=1 SV=2 482 747 4.0E-40
sp|P53549|PRS10_YEAST 26S protease subunit RPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT4 PE=1 SV=4 483 713 4.0E-40
sp|Q5R410|NSF_PONAB Vesicle-fusing ATPase OS=Pongo abelii GN=NSF PE=2 SV=1 482 718 4.0E-40
sp|Q980M1|PAN_SULSO Proteasome-activating nucleotidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pan PE=3 SV=1 482 713 5.0E-40
sp|Q67JH0|FTSH3_SYMTH ATP-dependent zinc metalloprotease FtsH 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH3 PE=3 SV=1 484 708 5.0E-40
sp|Q58576|PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pan PE=1 SV=1 482 715 6.0E-40
sp|Q9MAK9|PS10B_ARATH 26S protease regulatory subunit S10B homolog B OS=Arabidopsis thaliana GN=RPT4B PE=1 SV=1 483 713 7.0E-40
sp|D5HA94|FTSH2_SALRM ATP-dependent zinc metalloprotease FtsH 2 OS=Salinibacter ruber (strain M8) GN=ftsH2 PE=3 SV=1 483 734 9.0E-40
sp|P46470|PRS8_XENLA 26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2 481 738 9.0E-40
sp|Q2KIW6|PRS10_BOVIN 26S protease regulatory subunit 10B OS=Bos taurus GN=PSMC6 PE=2 SV=1 483 713 1.0E-39
sp|Q8PY58|PAN_METMA Proteasome-activating nucleotidase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pan PE=3 SV=1 483 714 1.0E-39
sp|O14114|YEJJ_SCHPO Uncharacterized AAA domain-containing protein C31G5.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.19 PE=3 SV=1 484 714 1.0E-39
sp|P62334|PRS10_MOUSE 26S protease regulatory subunit 10B OS=Mus musculus GN=Psmc6 PE=1 SV=1 483 713 1.0E-39
sp|P62335|PRS10_ICTTR 26S protease regulatory subunit 10B OS=Ictidomys tridecemlineatus GN=PSMC6 PE=2 SV=1 483 713 1.0E-39
sp|P62333|PRS10_HUMAN 26S protease regulatory subunit 10B OS=Homo sapiens GN=PSMC6 PE=1 SV=1 483 713 1.0E-39
sp|P78578|PRS6B_ASPNG 26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1 482 736 1.0E-39
sp|Q9FH02|FTSH5_ARATH ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana GN=FTSH5 PE=1 SV=1 475 708 2.0E-39
sp|B8GGN4|PAN_METPE Proteasome-activating nucleotidase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pan PE=3 SV=1 477 664 2.0E-39
sp|B2GIP2|ARC_KOCRD AAA ATPase forming ring-shaped complexes OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=arc PE=3 SV=1 481 655 2.0E-39
sp|P41836|PRS8_SCHPO 26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=let1 PE=3 SV=1 481 738 2.0E-39
sp|Q1XDF9|FTSH_PYRYE ATP-dependent zinc metalloprotease FtsH OS=Pyropia yezoensis GN=ftsH PE=3 SV=1 484 708 3.0E-39
sp|P54351|NSF2_DROME Vesicle-fusing ATPase 2 OS=Drosophila melanogaster GN=Nsf2 PE=2 SV=2 482 747 3.0E-39
sp|O78516|FTSH_GUITH ATP-dependent zinc metalloprotease FtsH OS=Guillardia theta GN=ftsH PE=3 SV=1 484 708 3.0E-39
sp|P72991|FTSH3_SYNY3 ATP-dependent zinc metalloprotease FtsH 3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH3 PE=1 SV=1 484 708 3.0E-39
sp|C5BVA6|ARC_BEUC1 Proteasome-associated ATPase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=arc PE=3 SV=1 481 664 3.0E-39
sp|P9WQN2|FTSH_MYCTO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsH PE=3 SV=1 481 708 4.0E-39
sp|P9WQN3|FTSH_MYCTU ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsH PE=1 SV=1 481 708 4.0E-39
sp|A5U8T5|FTSH_MYCTA ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsH PE=3 SV=1 481 708 4.0E-39
sp|P0A4V9|FTSH_MYCBO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsH PE=3 SV=1 481 708 4.0E-39
sp|B9KXV3|FTSH1_THERP ATP-dependent zinc metalloprotease FtsH 1 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH1 PE=3 SV=1 482 708 4.0E-39
sp|B0K657|FTSH2_THEPX ATP-dependent zinc metalloprotease FtsH 2 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH2 PE=3 SV=1 483 750 5.0E-39
sp|P54813|YME1_CAEEL ATP-dependent zinc metalloprotease YME1 homolog OS=Caenorhabditis elegans GN=ymel-1 PE=3 SV=2 484 708 5.0E-39
sp|A0PXM8|FTSH_CLONN ATP-dependent zinc metalloprotease FtsH OS=Clostridium novyi (strain NT) GN=ftsH PE=3 SV=1 458 708 5.0E-39
sp|Q6MJV1|FTSH2_BDEBA ATP-dependent zinc metalloprotease FtsH 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH2 PE=3 SV=1 484 727 7.0E-39
sp|B3DRN4|ARC_BIFLD AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum (strain DJO10A) GN=arc PE=3 SV=1 482 664 7.0E-39
sp|Q8G3G6|ARC_BIFLO AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum (strain NCC 2705) GN=arc PE=3 SV=1 482 664 7.0E-39
sp|B7GUP3|ARC_BIFLS AAA ATPase forming ring-shaped complexes OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=arc PE=3 SV=1 482 664 7.0E-39
sp|O82150|FTSH_TOBAC ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Nicotiana tabacum GN=FTSH PE=2 SV=2 475 708 8.0E-39
sp|Q9BAE0|FTSH_MEDSA ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Medicago sativa GN=FTSH PE=2 SV=1 475 708 8.0E-39
sp|D1J722|FTSH_ECTSI ATP-dependent zinc metalloprotease FtsH OS=Ectocarpus siliculosus GN=ftsH PE=3 SV=1 484 708 8.0E-39
sp|Q2FQ56|PAN_METHJ Proteasome-activating nucleotidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pan PE=3 SV=1 482 743 8.0E-39
sp|O19922|FTSH_CYACA ATP-dependent zinc metalloprotease FtsH OS=Cyanidium caldarium GN=ftsH PE=3 SV=1 484 708 9.0E-39
sp|D1C4U5|FTSH3_SPHTD ATP-dependent zinc metalloprotease FtsH 3 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH3 PE=3 SV=1 482 735 9.0E-39
sp|Q5Z974|FTSH1_ORYSJ ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH1 PE=2 SV=1 475 708 1.0E-38
sp|P46507|PRS6B_MANSE 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1 482 738 1.0E-38
sp|O17071|PRS10_CAEEL Probable 26S protease regulatory subunit 10B OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2 483 713 1.0E-38
sp|Q39444|FTSH_CAPAN ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) OS=Capsicum annuum GN=FTSH PE=2 SV=1 475 708 2.0E-38
sp|B8H444|FTSH_CAUCN ATP-dependent zinc metalloprotease FtsH OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ftsH PE=2 SV=1 484 714 2.0E-38
sp|B0K5A3|FTSH1_THEPX ATP-dependent zinc metalloprotease FtsH 1 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH1 PE=3 SV=1 484 708 2.0E-38
sp|Q39102|FTSH1_ARATH ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana GN=FTSH1 PE=1 SV=2 475 708 2.0E-38
sp|P46461|NSF1_DROME Vesicle-fusing ATPase 1 OS=Drosophila melanogaster GN=comt PE=2 SV=1 482 718 2.0E-38
sp|P51327|FTSH_PORPU ATP-dependent zinc metalloprotease FtsH OS=Porphyra purpurea GN=ftsH PE=3 SV=1 484 708 3.0E-38
sp|D2NT89|ARC_ROTMD AAA ATPase forming ring-shaped complexes OS=Rothia mucilaginosa (strain DY-18) GN=arc PE=3 SV=2 481 670 3.0E-38
sp|P54816|TBP7_CAEEL Tat-binding homolog 7 OS=Caenorhabditis elegans GN=lex-1 PE=1 SV=3 478 708 4.0E-38
sp|Q60QD1|FIGL1_CAEBR Fidgetin-like protein 1 OS=Caenorhabditis briggsae GN=figl-1 PE=3 SV=1 473 714 4.0E-38
sp|B4U7U4|FTSH_HYDS0 ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 482 714 4.0E-38
sp|Q975U2|PAN_SULTO Proteasome-activating nucleotidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pan PE=3 SV=2 478 713 4.0E-38
sp|P18759|SEC18_YEAST Vesicular-fusion protein SEC18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC18 PE=1 SV=2 472 719 6.0E-38
sp|Q1PDW5|FTSH6_ARATH ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1 484 708 6.0E-38
sp|A8F7F7|FTSH_PSELT ATP-dependent zinc metalloprotease FtsH OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ftsH PE=3 SV=1 484 708 7.0E-38
sp|P63343|FTSH_SALTY ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ftsH PE=3 SV=1 485 708 7.0E-38
sp|P63344|FTSH_SALTI ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhi GN=ftsH PE=3 SV=1 485 708 7.0E-38
sp|P0AAI4|FTSH_SHIFL ATP-dependent zinc metalloprotease FtsH OS=Shigella flexneri GN=ftsH PE=3 SV=1 485 708 8.0E-38
sp|P0AAI3|FTSH_ECOLI ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) GN=ftsH PE=1 SV=1 485 708 8.0E-38
sp|Q8X9L0|FTSH_ECO57 ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli O157:H7 GN=ftsH PE=3 SV=1 485 708 8.0E-38
sp|B8D065|FTSH_HALOH ATP-dependent zinc metalloprotease FtsH OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ftsH PE=3 SV=1 484 714 8.0E-38
sp|A3CV35|PAN_METMJ Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1 482 718 9.0E-38
sp|B9L3S8|FTSH2_THERP ATP-dependent zinc metalloprotease FtsH 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH2 PE=3 SV=1 482 735 1.0E-37
sp|A6LD25|FTSH_PARD8 ATP-dependent zinc metalloprotease FtsH OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ftsH PE=3 SV=1 484 708 1.0E-37
sp|Q9WZ49|FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1 484 735 1.0E-37
sp|D1C1U7|FTSH1_SPHTD ATP-dependent zinc metalloprotease FtsH 1 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH1 PE=3 SV=1 482 708 1.0E-37
sp|Q1AV13|FTSH_RUBXD ATP-dependent zinc metalloprotease FtsH OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ftsH PE=3 SV=1 482 708 1.0E-37
sp|Q6LUJ8|FTSH_PHOPR ATP-dependent zinc metalloprotease FtsH OS=Photobacterium profundum GN=ftsH PE=3 SV=1 485 708 1.0E-37
sp|B3DY14|FTSH2_METI4 ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1 484 714 1.0E-37
sp|C0ZPK5|FTSH_RHOE4 ATP-dependent zinc metalloprotease FtsH OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ftsH PE=3 SV=1 463 708 1.0E-37
sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1 481 716 2.0E-37
sp|A7I8B8|PAN_METB6 Proteasome-activating nucleotidase OS=Methanoregula boonei (strain 6A8) GN=pan PE=3 SV=1 482 674 2.0E-37
sp|A9EXK6|FTSH4_SORC5 ATP-dependent zinc metalloprotease FtsH 4 OS=Sorangium cellulosum (strain So ce56) GN=ftsH4 PE=3 SV=1 484 734 2.0E-37
sp|Q8K9G8|FTSH_BUCAP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsH PE=3 SV=1 485 708 2.0E-37
sp|Q1LLA9|FTSH_CUPMC ATP-dependent zinc metalloprotease FtsH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ftsH PE=3 SV=1 432 708 2.0E-37
sp|Q9P7Q4|SEC18_SCHPO Vesicular-fusion protein sec18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec18 PE=1 SV=1 489 719 2.0E-37
sp|Q9CD58|FTSH_MYCLE ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium leprae (strain TN) GN=ftsH PE=3 SV=1 481 708 3.0E-37
sp|C6V4R9|FTSH_NEORI ATP-dependent zinc metalloprotease FtsH OS=Neorickettsia risticii (strain Illinois) GN=ftsH PE=3 SV=1 484 734 3.0E-37
sp|A9KIG5|FTSH_CLOPH ATP-dependent zinc metalloprotease FtsH OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ftsH PE=3 SV=1 484 708 3.0E-37
sp|Q2LUQ1|FTSH_SYNAS ATP-dependent zinc metalloprotease FtsH OS=Syntrophus aciditrophicus (strain SB) GN=ftsH PE=3 SV=1 484 708 3.0E-37
sp|O74894|PRS6B_SCHPO 26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt3 PE=3 SV=1 482 749 4.0E-37
sp|B9MPK5|FTSH_CALBD ATP-dependent zinc metalloprotease FtsH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ftsH PE=3 SV=1 464 699 4.0E-37
sp|F4IAE9|Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana GN=At1g05910 PE=2 SV=1 483 708 4.0E-37
sp|C7N914|FTSH_LEPBD ATP-dependent zinc metalloprotease FtsH OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) GN=ftsH PE=3 SV=1 482 708 5.0E-37
sp|Q6MLS7|FTSH1_BDEBA ATP-dependent zinc metalloprotease FtsH 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH1 PE=3 SV=1 484 708 5.0E-37
sp|A8X0L9|TBP7_CAEBR Tat-binding homolog 7 OS=Caenorhabditis briggsae GN=lex-1 PE=3 SV=2 478 708 6.0E-37
sp|D1CDT8|FTSH_THET1 ATP-dependent zinc metalloprotease FtsH OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=ftsH PE=3 SV=1 484 708 6.0E-37
sp|P71377|FTSH_HAEIN ATP-dependent zinc metalloprotease FtsH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsH PE=3 SV=1 484 708 7.0E-37
sp|P32795|YME1_YEAST Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YME1 PE=1 SV=1 483 714 7.0E-37
sp|A9BJK3|FTSH3_PETMO ATP-dependent zinc metalloprotease FtsH 3 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH3 PE=3 SV=1 459 708 7.0E-37
sp|A4IHT0|FIGL1_XENTR Fidgetin-like protein 1 OS=Xenopus tropicalis GN=fignl1 PE=2 SV=1 482 749 8.0E-37
sp|C7M0M0|FTSH_ACIFD ATP-dependent zinc metalloprotease FtsH OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=ftsH PE=3 SV=1 482 734 8.0E-37
sp|P57462|FTSH_BUCAI ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsH PE=3 SV=2 485 708 8.0E-37
sp|B8G4Q6|FTSH_CHLAD ATP-dependent zinc metalloprotease FtsH OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ftsH PE=3 SV=1 482 708 1.0E-36
sp|C1F8X6|FTSH_ACIC5 ATP-dependent zinc metalloprotease FtsH OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ftsH PE=3 SV=1 484 712 1.0E-36
sp|C5CES8|FTSH_KOSOT ATP-dependent zinc metalloprotease FtsH OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ftsH PE=3 SV=1 469 708 1.0E-36
sp|O74445|PRS10_SCHPO Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt4 PE=3 SV=2 483 714 1.0E-36
sp|D0MGU8|FTSH_RHOM4 ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1 484 718 2.0E-36
sp|Q89AF2|FTSH_BUCBP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsH PE=3 SV=1 484 708 2.0E-36
sp|B3DV46|FTSH1_METI4 ATP-dependent zinc metalloprotease FtsH 1 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH1 PE=3 SV=1 484 666 2.0E-36
sp|B8J992|FTSH_ANAD2 ATP-dependent zinc metalloprotease FtsH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ftsH PE=3 SV=1 484 708 3.0E-36
sp|Q9SEI4|PRS6B_ARATH 26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1 482 749 3.0E-36
sp|Q6DDU8|FIGL1_XENLA Fidgetin-like protein 1 OS=Xenopus laevis GN=fignl1 PE=2 SV=1 482 749 3.0E-36
sp|A9BHD3|FTSH2_PETMO ATP-dependent zinc metalloprotease FtsH 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH2 PE=3 SV=1 484 708 3.0E-36
sp|P85200|PRS6B_HELAN 26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1 482 671 3.0E-36
sp|Q4L3G8|FTSH_STAHJ ATP-dependent zinc metalloprotease FtsH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ftsH PE=3 SV=1 484 708 3.0E-36
sp|A8ZNZ4|FTSH_ACAM1 ATP-dependent zinc metalloprotease FtsH OS=Acaryochloris marina (strain MBIC 11017) GN=ftsH PE=3 SV=1 484 708 4.0E-36
sp|Q04Q03|FTSH_LEPBJ ATP-dependent zinc metalloprotease FtsH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ftsH PE=3 SV=1 467 712 4.0E-36
sp|B2JVU2|FTSH_BURP8 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ftsH PE=3 SV=1 484 708 4.0E-36
sp|Q75JI3|NSF_DICDI Vesicle-fusing ATPase OS=Dictyostelium discoideum GN=nsfA PE=1 SV=1 486 718 4.0E-36
sp|C8W731|FTSH_ATOPD ATP-dependent zinc metalloprotease FtsH OS=Atopobium parvulum (strain ATCC 33793 / DSM 20469 / JCM 10300 / VPI 0546) GN=ftsH PE=3 SV=1 484 708 5.0E-36
sp|P28737|MSP1_YEAST Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2 480 717 5.0E-36
sp|A1URA3|FTSH_BARBK ATP-dependent zinc metalloprotease FtsH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ftsH PE=3 SV=1 484 708 5.0E-36
sp|Q4R7L3|PRS6B_MACFA 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1 482 734 5.0E-36
sp|P43686|PRS6B_HUMAN 26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2 482 734 5.0E-36
sp|Q3T030|PRS6B_BOVIN 26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1 482 734 5.0E-36
sp|Q63570|PRS6B_RAT 26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1 482 734 6.0E-36
sp|P54775|PRS6B_MOUSE 26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2 482 734 6.0E-36
sp|B2XTF7|FTSH_HETA2 ATP-dependent zinc metalloprotease FtsH OS=Heterosigma akashiwo (strain NIES-293) GN=ftsH PE=3 SV=1 507 708 7.0E-36
sp|D1C2C6|FTSH2_SPHTD ATP-dependent zinc metalloprotease FtsH 2 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH2 PE=3 SV=1 484 708 7.0E-36
sp|B7T1V0|FTSH_VAULI ATP-dependent zinc metalloprotease FtsH OS=Vaucheria litorea GN=ftsH PE=3 SV=1 483 708 7.0E-36
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 489 717 8.0E-36
sp|B8I4B9|FTSH_CLOCE ATP-dependent zinc metalloprotease FtsH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ftsH PE=3 SV=1 484 708 8.0E-36
sp|P75120|FTSH_MYCPN ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsH PE=3 SV=1 484 707 8.0E-36
sp|Q68XR9|FTSH_RICTY ATP-dependent zinc metalloprotease FtsH OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsH PE=3 SV=1 482 708 8.0E-36
sp|Q92JJ9|FTSH_RICCN ATP-dependent zinc metalloprotease FtsH OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsH PE=3 SV=1 482 708 8.0E-36
sp|Q0VA52|SPA5L_XENTR Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1 218 576 9.0E-36
sp|Q9ZEA2|FTSH_RICPR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia prowazekii (strain Madrid E) GN=ftsH PE=3 SV=1 482 708 9.0E-36
sp|Q4UN68|FTSH_RICFE ATP-dependent zinc metalloprotease FtsH OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsH PE=3 SV=1 482 708 1.0E-35
sp|B3R057|FTSH1_PHYMT ATP-dependent zinc metalloprotease FtsH 1 OS=Phytoplasma mali (strain AT) GN=ftsH1 PE=3 SV=1 485 665 1.0E-35
sp|Q6MDI5|FTSH_PARUW ATP-dependent zinc metalloprotease FtsH OS=Protochlamydia amoebophila (strain UWE25) GN=ftsH PE=3 SV=1 484 708 1.0E-35
sp|Q6M2F0|FTSH_CORGL ATP-dependent zinc metalloprotease FtsH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ftsH PE=3 SV=1 481 708 1.0E-35
sp|D3FFN2|FTSH_MYCGH ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma gallisepticum (strain R(high / passage 156)) GN=ftsH PE=3 SV=1 486 707 1.0E-35
sp|P47695|FTSH_MYCGE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsH PE=3 SV=1 484 707 1.0E-35
sp|Q83FV7|FTSH_TROWT ATP-dependent zinc metalloprotease FtsH OS=Tropheryma whipplei (strain Twist) GN=ftsH PE=3 SV=1 481 708 1.0E-35
sp|P62193|PRS4_RAT 26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1 482 714 1.0E-35
sp|P62192|PRS4_MOUSE 26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1 482 714 1.0E-35
sp|P62191|PRS4_HUMAN 26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1 482 714 1.0E-35
sp|Q90732|PRS4_CHICK 26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1 482 714 1.0E-35
sp|A6TWP7|FTSH2_ALKMQ ATP-dependent zinc metalloprotease FtsH 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH2 PE=3 SV=1 484 708 1.0E-35
sp|O88967|YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=1 SV=1 481 734 2.0E-35
sp|Q9M0Y8|NSF_ARATH Vesicle-fusing ATPase OS=Arabidopsis thaliana GN=NSF PE=2 SV=2 510 716 2.0E-35
sp|P46502|PRS6B_CAEEL Probable 26S protease regulatory subunit 6B OS=Caenorhabditis elegans GN=rpt-3 PE=3 SV=1 482 749 2.0E-35
sp|Q8EUA6|FTSH_MYCPE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma penetrans (strain HF-2) GN=ftsH PE=3 SV=1 507 707 2.0E-35
sp|A1TZE0|FTSH_MARHV ATP-dependent zinc metalloprotease FtsH OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ftsH PE=3 SV=1 485 708 2.0E-35
sp|Q5RII9|KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio GN=katna1 PE=2 SV=1 467 718 2.0E-35
sp|Q8SRH0|PRS4_ENCCU 26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT2 PE=1 SV=1 482 714 2.0E-35
sp|P54778|PRS6B_SOLTU 26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1 482 671 2.0E-35
sp|A2SHH9|FTSH_METPP ATP-dependent zinc metalloprotease FtsH OS=Methylibium petroleiphilum (strain PM1) GN=ftsH PE=3 SV=1 484 743 2.0E-35
sp|Q9C0W2|YHI5_SCHPO Uncharacterized AAA domain-containing protein P22H7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi026 PE=3 SV=1 483 714 3.0E-35
sp|D0LWB8|FTSH_HALO1 ATP-dependent zinc metalloprotease FtsH OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=ftsH PE=3 SV=1 484 708 3.0E-35
sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2 481 734 3.0E-35
sp|D3F124|FTSH1_CONWI ATP-dependent zinc metalloprotease FtsH 1 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH1 PE=3 SV=1 482 708 3.0E-35
sp|P48601|PRS4_DROME 26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Rpt2 PE=1 SV=2 482 714 4.0E-35
sp|P46508|YME1_SCHMA ATP-dependent zinc metalloprotease YME1 homolog OS=Schistosoma mansoni PE=2 SV=1 483 711 4.0E-35
sp|Q60AK1|FTSH_METCA ATP-dependent zinc metalloprotease FtsH OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ftsH PE=3 SV=1 484 700 4.0E-35
sp|P40327|PRS4_YEAST 26S protease regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3 482 714 4.0E-35
sp|P94304|FTSH_BACPE ATP-dependent zinc metalloprotease FtsH OS=Bacillus pseudofirmus (strain OF4) GN=ftsH PE=3 SV=2 486 708 4.0E-35
sp|A0L4S0|FTSH_MAGMM ATP-dependent zinc metalloprotease FtsH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ftsH PE=3 SV=1 484 713 5.0E-35
sp|A0LN68|FTSH_SYNFM ATP-dependent zinc metalloprotease FtsH OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=ftsH PE=3 SV=1 484 708 6.0E-35
sp|Q9HGM3|YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1 484 712 6.0E-35
sp|Q8BPY9|FIGL1_MOUSE Fidgetin-like protein 1 OS=Mus musculus GN=Fignl1 PE=1 SV=1 482 750 6.0E-35
sp|Q3B6R3|FTSH_CHLL7 ATP-dependent zinc metalloprotease FtsH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ftsH PE=3 SV=1 484 666 7.0E-35
sp|A9BFL9|FTSH1_PETMO ATP-dependent zinc metalloprotease FtsH 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH1 PE=3 SV=1 463 708 8.0E-35
sp|D1C8C0|FTSH4_SPHTD ATP-dependent zinc metalloprotease FtsH 4 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsh4 PE=3 SV=1 482 714 9.0E-35
sp|Q2NIN5|FTSH_AYWBP ATP-dependent zinc metalloprotease FtsH OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ftsH PE=3 SV=1 485 702 9.0E-35
sp|B1GZK7|FTSH_UNCTG ATP-dependent zinc metalloprotease FtsH OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ftsH PE=3 SV=1 484 708 1.0E-34
sp|O75449|KTNA1_HUMAN Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens GN=KATNA1 PE=1 SV=1 467 718 1.0E-34
sp|Q925S8|YMEL1_RAT ATP-dependent zinc metalloprotease YME1L1 OS=Rattus norvegicus GN=Yme1l1 PE=2 SV=1 481 734 1.0E-34
sp|B5X3X5|KTNA1_SALSA Katanin p60 ATPase-containing subunit A1 OS=Salmo salar GN=katna1 PE=2 SV=1 467 718 1.0E-34
sp|P73437|FTSH4_SYNY3 ATP-dependent zinc metalloprotease FtsH 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH4 PE=2 SV=1 484 708 1.0E-34
sp|B7J0N5|FTSH_BORBZ ATP-dependent zinc metalloprotease FtsH OS=Borrelia burgdorferi (strain ZS7) GN=ftsH PE=3 SV=1 484 712 1.0E-34
sp|Q4R407|KTNA1_MACFA Katanin p60 ATPase-containing subunit A1 OS=Macaca fascicularis GN=KATNA1 PE=2 SV=1 467 718 1.0E-34
sp|Q6GX84|FIGL1_RAT Fidgetin-like protein 1 OS=Rattus norvegicus GN=Fignl1 PE=2 SV=1 482 749 1.0E-34
sp|P46465|PRS6A_ORYSJ 26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2 482 714 1.0E-34
sp|D5D8E3|FTSH_SULMD ATP-dependent zinc metalloprotease FtsH OS=Sulcia muelleri (strain DMIN) GN=ftsH PE=3 SV=1 483 708 1.0E-34
sp|Q1RGP0|FTSH_RICBR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia bellii (strain RML369-C) GN=ftsH PE=3 SV=1 482 707 1.0E-34
sp|D1BLD0|FTSH_VEIPT ATP-dependent zinc metalloprotease FtsH OS=Veillonella parvula (strain ATCC 10790 / DSM 2008 / JCM 12972 / Te3) GN=ftsH PE=3 SV=1 484 701 2.0E-34
sp|O75351|VPS4B_HUMAN Vacuolar protein sorting-associated protein 4B OS=Homo sapiens GN=VPS4B PE=1 SV=2 476 701 2.0E-34
sp|P37476|FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) GN=ftsH PE=1 SV=1 455 708 2.0E-34
sp|Q6PIW4|FIGL1_HUMAN Fidgetin-like protein 1 OS=Homo sapiens GN=FIGNL1 PE=1 SV=2 482 749 2.0E-34
sp|Q5AG40|VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1 482 655 3.0E-34
sp|O83746|FTSH_TREPA ATP-dependent zinc metalloprotease FtsH OS=Treponema pallidum (strain Nichols) GN=ftsH PE=3 SV=1 489 708 3.0E-34
sp|Q5R658|VPS4B_PONAB Vacuolar protein sorting-associated protein 4B OS=Pongo abelii GN=VPS4B PE=2 SV=1 476 701 3.0E-34
sp|B4SCV5|FTSH_PELPB ATP-dependent zinc metalloprotease FtsH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ftsH PE=3 SV=1 485 708 3.0E-34
sp|Q9UQ90|SPG7_HUMAN Paraplegin OS=Homo sapiens GN=SPG7 PE=1 SV=2 473 741 3.0E-34
sp|A9NE17|FTSH_ACHLI ATP-dependent zinc metalloprotease FtsH OS=Acholeplasma laidlawii (strain PG-8A) GN=ftsH PE=3 SV=1 484 700 4.0E-34
sp|Q9M895|FTSI3_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic OS=Arabidopsis thaliana GN=FTSHI3 PE=1 SV=1 482 744 4.0E-34
sp|Q3JEE4|FTSH_NITOC ATP-dependent zinc metalloprotease FtsH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ftsH PE=3 SV=1 484 708 5.0E-34
sp|Q0DHL4|FTSH8_ORYSJ ATP-dependent zinc metalloprotease FTSH 8, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH8 PE=3 SV=1 484 708 6.0E-34
sp|A6TSZ1|FTSH1_ALKMQ ATP-dependent zinc metalloprotease FtsH 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH1 PE=3 SV=1 484 708 6.0E-34
sp|Q9PUL2|KTNA1_XENLA Katanin p60 ATPase-containing subunit A1 (Fragment) OS=Xenopus laevis GN=katna1 PE=2 SV=1 467 718 6.0E-34
sp|Q9SEI2|PS6AA_ARATH 26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=1 SV=1 482 714 7.0E-34
sp|O23894|PRS6A_BRACM 26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1 482 714 7.0E-34
sp|Q0IIR9|KTNA1_XENTR Katanin p60 ATPase-containing subunit A1 OS=Xenopus tropicalis GN=katna1 PE=2 SV=1 467 718 7.0E-34
sp|P54776|PRS6A_SOLLC 26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1 482 714 7.0E-34
sp|A5W382|FTSH_PSEP1 ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ftsH PE=3 SV=1 484 717 8.0E-34
sp|Q1HGK7|KTNA1_CHICK Katanin p60 ATPase-containing subunit A1 OS=Gallus gallus GN=KATNA1 PE=2 SV=1 467 718 8.0E-34
sp|Q67WJ2|FTSH6_ORYSJ ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1 484 708 8.0E-34
sp|B1ZMG6|FTSH_OPITP ATP-dependent zinc metalloprotease FtsH OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ftsH PE=3 SV=1 480 708 9.0E-34
sp|A0LR74|FTSH_ACIC1 ATP-dependent zinc metalloprotease FtsH OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ftsH PE=3 SV=1 482 703 9.0E-34
sp|Q9SS94|CD48C_ARATH Cell division control protein 48 homolog C OS=Arabidopsis thaliana GN=CDC48C PE=2 SV=2 485 718 1.0E-33
sp|B3QZS3|FTSH2_PHYMT ATP-dependent zinc metalloprotease FtsH 2 OS=Phytoplasma mali (strain AT) GN=ftsH2 PE=3 SV=1 483 708 1.0E-33
sp|Q3A579|FTSH_PELCD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ftsH PE=3 SV=1 484 708 1.0E-33
sp|Q67LC0|FTSH1_SYMTH ATP-dependent zinc metalloprotease FtsH 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH1 PE=3 SV=1 484 708 1.0E-33
sp|P46467|VPS4B_MOUSE Vacuolar protein sorting-associated protein 4B OS=Mus musculus GN=Vps4b PE=1 SV=2 476 701 1.0E-33
sp|B2UMY1|FTSH_AKKM8 ATP-dependent zinc metalloprotease FtsH OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ftsH PE=3 SV=1 484 734 1.0E-33
sp|Q2SF13|FTSH_HAHCH ATP-dependent zinc metalloprotease FtsH OS=Hahella chejuensis (strain KCTC 2396) GN=ftsH PE=3 SV=1 482 708 1.0E-33
sp|Q9VQN8|FIGL1_DROME Fidgetin-like protein 1 OS=Drosophila melanogaster GN=CG3326 PE=2 SV=2 484 713 1.0E-33
sp|P34123|PRS6B_DICDI 26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1 482 743 1.0E-33
sp|D3FA80|FTSH2_CONWI ATP-dependent zinc metalloprotease FtsH 2 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH2 PE=3 SV=1 464 708 1.0E-33
sp|P52917|VPS4_YEAST Vacuolar protein sorting-associated protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS4 PE=1 SV=1 482 664 1.0E-33
sp|D2QZ34|FTSH_PIRSD ATP-dependent zinc metalloprotease FtsH OS=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) GN=ftsH PE=3 SV=1 484 703 1.0E-33
sp|O04019|PS6AB_ARATH 26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3 482 714 1.0E-33
sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1 483 708 2.0E-33
sp|Q7URM7|FTSH2_RHOBA ATP-dependent zinc metalloprotease FtsH 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH2 PE=3 SV=1 485 708 2.0E-33
sp|B2A3Q4|FTSH_NATTJ ATP-dependent zinc metalloprotease FtsH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ftsH PE=3 SV=1 507 708 2.0E-33
sp|Q3ULF4|SPG7_MOUSE Paraplegin OS=Mus musculus GN=Spg7 PE=1 SV=1 473 735 2.0E-33
sp|B0B970|FTSH_CHLT2 ATP-dependent zinc metalloprotease FtsH OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ftsH PE=3 SV=1 484 699 2.0E-33
sp|Q8MNV0|SPAST_CAEEL Probable spastin homolog spas-1 OS=Caenorhabditis elegans GN=spas-1 PE=1 SV=2 484 741 2.0E-33
sp|A9GRC9|FTSH1_SORC5 ATP-dependent zinc metalloprotease FtsH 1 OS=Sorangium cellulosum (strain So ce56) GN=ftsH1 PE=3 SV=1 484 701 2.0E-33
sp|Q9FIM2|FTSH9_ARATH ATP-dependent zinc metalloprotease FTSH 9, chloroplastic OS=Arabidopsis thaliana GN=FTSH9 PE=2 SV=1 484 743 3.0E-33
sp|B3R0R7|FTSH3_PHYMT ATP-dependent zinc metalloprotease FtsH 3 OS=Phytoplasma mali (strain AT) GN=ftsH3 PE=3 SV=1 485 708 3.0E-33
sp|Q09803|VPS4_SCHPO Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps4 PE=3 SV=1 456 701 3.0E-33
sp|P34732|SEC18_CANAX Vesicular-fusion protein SEC18 OS=Candida albicans GN=SEC18 PE=3 SV=2 489 747 3.0E-33
sp|Q0VA52|SPA5L_XENTR Spermatogenesis-associated protein 5-like protein 1 OS=Xenopus tropicalis GN=spata5l1 PE=2 SV=1 489 712 4.0E-33
sp|Q8S2A7|FTSH3_ORYSJ ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH3 PE=3 SV=1 484 708 4.0E-33
sp|Q920A7|AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus GN=Afg3l1 PE=1 SV=2 483 708 4.0E-33
sp|O69076|FTSH_STRPN ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ftsH PE=3 SV=3 484 708 4.0E-33
sp|P59652|FTSH_STRR6 ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ftsH PE=3 SV=1 484 708 5.0E-33
sp|Q2KJI7|AFG32_BOVIN AFG3-like protein 2 OS=Bos taurus GN=AFG3L2 PE=2 SV=1 483 708 5.0E-33
sp|Q9UN37|VPS4A_HUMAN Vacuolar protein sorting-associated protein 4A OS=Homo sapiens GN=VPS4A PE=1 SV=1 482 701 5.0E-33
sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2 483 708 5.0E-33
sp|Q793F9|VPS4A_RAT Vacuolar protein sorting-associated protein 4A OS=Rattus norvegicus GN=Vps4a PE=1 SV=1 482 701 5.0E-33
sp|Q8VEJ9|VPS4A_MOUSE Vacuolar protein sorting-associated protein 4A OS=Mus musculus GN=Vps4a PE=1 SV=1 482 701 5.0E-33
sp|C7N1I1|FTSH_SLAHD ATP-dependent zinc metalloprotease FtsH OS=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) GN=ftsH PE=3 SV=1 482 708 6.0E-33
sp|Q6E0V2|KTNA1_RAT Katanin p60 ATPase-containing subunit A1 OS=Rattus norvegicus GN=Katna1 PE=1 SV=1 467 718 6.0E-33
sp|Q7UUZ7|FTSH1_RHOBA ATP-dependent zinc metalloprotease FtsH 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH1 PE=3 SV=1 484 734 6.0E-33
sp|Q0VD48|VPS4B_BOVIN Vacuolar protein sorting-associated protein 4B OS=Bos taurus GN=VPS4B PE=2 SV=1 476 701 7.0E-33
sp|D4HA34|FTSH_PROAS ATP-dependent zinc metalloprotease FtsH OS=Propionibacterium acnes (strain SK137) GN=ftsH PE=3 SV=1 475 708 7.0E-33
sp|Q3JMH0|FTSH_BURP1 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia pseudomallei (strain 1710b) GN=ftsH PE=3 SV=2 484 708 8.0E-33
sp|Q5ZK92|SPAST_CHICK Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1 482 714 9.0E-33
sp|O16368|PRS4_CAEEL Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=3 SV=1 482 714 1.0E-32
sp|Q6H6R9|FTSH7_ORYSJ ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH7 PE=3 SV=1 484 743 1.0E-32
sp|Q8SR13|PRS6A_ENCCU 26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT5 PE=1 SV=1 482 714 1.0E-32
sp|Q9SD67|FTSH7_ARATH ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Arabidopsis thaliana GN=FTSH7 PE=2 SV=1 484 708 1.0E-32
sp|Q6NW58|SPAST_DANRE Spastin OS=Danio rerio GN=spast PE=2 SV=2 459 714 1.0E-32
sp|P46466|PRS4_ORYSJ 26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2 482 714 1.0E-32
sp|C7MC16|FTSH_BRAFD ATP-dependent zinc metalloprotease FtsH OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=ftsH PE=3 SV=1 482 708 1.0E-32
sp|Q9WV86|KTNA1_MOUSE Katanin p60 ATPase-containing subunit A1 OS=Mus musculus GN=Katna1 PE=1 SV=1 467 718 2.0E-32
sp|D2NQQ7|FTSH_ROTMD ATP-dependent zinc metalloprotease FtsH OS=Rothia mucilaginosa (strain DY-18) GN=ftsH PE=3 SV=1 464 708 2.0E-32
sp|Q0TTK8|FTSH_CLOP1 ATP-dependent zinc metalloprotease FtsH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ftsH PE=3 SV=1 484 708 2.0E-32
sp|Q8LQJ8|FTSH5_ORYSJ ATP-dependent zinc metalloprotease FTSH 5, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH5 PE=3 SV=1 483 734 2.0E-32
sp|B2UE66|FTSH_RALPJ ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1 484 735 2.0E-32
sp|Q1D491|FTSH_MYXXD ATP-dependent zinc metalloprotease FtsH OS=Myxococcus xanthus (strain DK 1622) GN=ftsH PE=3 SV=1 484 708 2.0E-32
sp|D5H7Z5|FTSH1_SALRM ATP-dependent zinc metalloprotease FtsH 1 OS=Salinibacter ruber (strain M8) GN=ftsH1 PE=3 SV=1 484 708 2.0E-32
sp|O22993|FTSI1_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic OS=Arabidopsis thaliana GN=FTSHI1 PE=1 SV=1 484 714 2.0E-32
sp|O67077|FTSH_AQUAE ATP-dependent zinc metalloprotease FtsH OS=Aquifex aeolicus (strain VF5) GN=ftsH PE=1 SV=1 507 699 2.0E-32
sp|A8XV40|SPAST_CAEBR Probable spastin homolog spas-1 OS=Caenorhabditis briggsae GN=spas-1 PE=3 SV=2 484 744 2.0E-32
sp|Q9ZM66|FTSH_HELPJ ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsH PE=3 SV=1 482 708 3.0E-32
sp|P71408|FTSH_HELPY ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsH PE=1 SV=2 482 708 3.0E-32
sp|A6QBN8|FTSH_SULNB ATP-dependent zinc metalloprotease FtsH OS=Sulfurovum sp. (strain NBC37-1) GN=ftsH PE=3 SV=1 482 708 3.0E-32
sp|Q9SL67|PRS4B_ARATH 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=1 SV=1 482 714 3.0E-32
sp|B3EX35|KATL1_SORAR Katanin p60 ATPase-containing subunit A-like 1 OS=Sorex araneus GN=KATNAL1 PE=3 SV=1 455 714 3.0E-32
sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2 489 741 4.0E-32
sp|P40328|TBP6_YEAST Probable 26S protease subunit YTA6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA6 PE=1 SV=2 484 742 4.0E-32
sp|Q55BV5|PRS4_DICDI 26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1 482 714 4.0E-32
sp|Q6AZT2|SPAST_XENLA Spastin OS=Xenopus laevis GN=spast PE=2 SV=1 482 714 4.0E-32
sp|Q9SEX2|KTNA1_ARATH Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana GN=AAA1 PE=1 SV=1 473 714 4.0E-32
sp|C8WEG0|FTSH_ZYMMN ATP-dependent zinc metalloprotease FtsH OS=Zymomonas mobilis subsp. mobilis (strain NCIMB 11163 / B70) GN=ftsH PE=3 SV=1 484 734 5.0E-32
sp|O32617|FTSH_HELFC ATP-dependent zinc metalloprotease FtsH OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ftsH PE=3 SV=1 482 708 6.0E-32
sp|A9FDV9|FTSH2_SORC5 ATP-dependent zinc metalloprotease FtsH 2 OS=Sorangium cellulosum (strain So ce56) GN=ftsH2 PE=3 SV=1 485 722 6.0E-32
sp|Q5U3S1|KATL1_DANRE Katanin p60 ATPase-containing subunit A-like 1 OS=Danio rerio GN=katnal1 PE=2 SV=1 482 714 6.0E-32
sp|Q8LQJ9|FTSH4_ORYSJ ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH4 PE=3 SV=1 486 734 6.0E-32
sp|Q5SI82|FTSH_THET8 ATP-dependent zinc metalloprotease FtsH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ftsH PE=1 SV=1 469 699 7.0E-32
sp|O80983|FTSH4_ARATH ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2 486 734 7.0E-32
sp|B7PXE3|SPAST_IXOSC Spastin OS=Ixodes scapularis GN=spas PE=3 SV=1 482 714 7.0E-32
sp|P33297|PRS6A_YEAST 26S protease regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT5 PE=1 SV=3 482 713 8.0E-32
sp|A9RA82|KATL1_PAPAN Katanin p60 ATPase-containing subunit A-like 1 OS=Papio anubis GN=KATNAL1 PE=3 SV=1 467 742 9.0E-32
sp|Q6KHA4|FTSH_MYCMO ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ftsH PE=3 SV=1 480 708 1.0E-31
sp|Q7TT47|SPG7_RAT Paraplegin OS=Rattus norvegicus GN=Spg7 PE=2 SV=1 473 664 1.0E-31
sp|Q6F0E5|FTSH_MESFL ATP-dependent zinc metalloprotease FtsH OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ftsH PE=3 SV=1 483 708 1.0E-31
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 489 712 6.0E-30
sp|Q54SY2|NVL_DICDI Putative ribosome biogenesis ATPase nvl OS=Dictyostelium discoideum GN=nvl PE=3 SV=1 480 722 5.0E-29
sp|Q9ZPR1|CD48B_ARATH Cell division control protein 48 homolog B OS=Arabidopsis thaliana GN=CDC48B PE=2 SV=1 489 714 8.0E-26
sp|Q58556|Y1156_METJA Cell division cycle protein 48 homolog MJ1156 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1156 PE=3 SV=1 188 393 6.0E-20
sp|O28972|Y1297_ARCFU Cell division cycle protein 48 homolog AF_1297 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=AF_1297 PE=3 SV=1 188 393 2.0E-18
sp|Q7KN62|TERA_DROME Transitional endoplasmic reticulum ATPase TER94 OS=Drosophila melanogaster GN=TER94 PE=1 SV=1 126 400 1.0E-17
sp|Q58576|PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pan PE=1 SV=1 165 400 3.0E-17
sp|Q07590|SAV_SULAC Protein SAV OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=sav PE=3 SV=2 207 473 4.0E-17
sp|P94304|FTSH_BACPE ATP-dependent zinc metalloprotease FtsH OS=Bacillus pseudofirmus (strain OF4) GN=ftsH PE=3 SV=2 204 400 4.0E-17
sp|O32617|FTSH_HELFC ATP-dependent zinc metalloprotease FtsH OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=ftsH PE=3 SV=1 207 400 4.0E-17
sp|P46462|TERA_RAT Transitional endoplasmic reticulum ATPase OS=Rattus norvegicus GN=Vcp PE=1 SV=3 126 400 5.0E-17
sp|Q01853|TERA_MOUSE Transitional endoplasmic reticulum ATPase OS=Mus musculus GN=Vcp PE=1 SV=4 126 400 5.0E-17
sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 126 400 5.0E-17
sp|P72991|FTSH3_SYNY3 ATP-dependent zinc metalloprotease FtsH 3 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH3 PE=1 SV=1 204 400 5.0E-17
sp|Q3ZBT1|TERA_BOVIN Transitional endoplasmic reticulum ATPase OS=Bos taurus GN=VCP PE=2 SV=1 126 400 6.0E-17
sp|P03974|TERA_PIG Transitional endoplasmic reticulum ATPase OS=Sus scrofa GN=VCP PE=1 SV=5 126 400 6.0E-17
sp|C7N914|FTSH_LEPBD ATP-dependent zinc metalloprotease FtsH OS=Leptotrichia buccalis (strain ATCC 14201 / DSM 1135 / JCM 12969 / NCTC 10249 / C-1013-b) GN=ftsH PE=3 SV=1 187 400 6.0E-17
sp|Q6GL04|TERA_XENTR Transitional endoplasmic reticulum ATPase OS=Xenopus tropicalis GN=vcp PE=2 SV=1 126 400 8.0E-17
sp|Q7URM7|FTSH2_RHOBA ATP-dependent zinc metalloprotease FtsH 2 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH2 PE=3 SV=1 188 400 8.0E-17
sp|Q9ZM66|FTSH_HELPJ ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ftsH PE=3 SV=1 207 400 9.0E-17
sp|Q5AWS6|CDC48_EMENI Cell division control protein 48 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=cdc48 PE=1 SV=2 126 402 1.0E-16
sp|P54811|TERA1_CAEEL Transitional endoplasmic reticulum ATPase homolog 1 OS=Caenorhabditis elegans GN=cdc-48.1 PE=1 SV=1 141 413 1.0E-16
sp|Q5BL07|PEX1_MOUSE Peroxisome biogenesis factor 1 OS=Mus musculus GN=Pex1 PE=1 SV=2 188 400 1.0E-16
sp|Q67LC0|FTSH1_SYMTH ATP-dependent zinc metalloprotease FtsH 1 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH1 PE=3 SV=1 204 400 1.0E-16
sp|P71408|FTSH_HELPY ATP-dependent zinc metalloprotease FtsH OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ftsH PE=1 SV=2 207 400 1.0E-16
sp|P23787|TERA_XENLA Transitional endoplasmic reticulum ATPase OS=Xenopus laevis GN=vcp PE=1 SV=3 126 400 2.0E-16
sp|P25694|CDC48_YEAST Cell division control protein 48 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC48 PE=1 SV=3 126 400 2.0E-16
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 207 396 2.0E-16
sp|Q54GX5|PEX1_DICDI Peroxisome biogenesis factor 1 OS=Dictyostelium discoideum GN=pex1 PE=3 SV=1 207 400 2.0E-16
sp|A7I8B8|PAN_METB6 Proteasome-activating nucleotidase OS=Methanoregula boonei (strain 6A8) GN=pan PE=3 SV=1 177 400 2.0E-16
sp|B9MPK5|FTSH_CALBD ATP-dependent zinc metalloprotease FtsH OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=ftsH PE=3 SV=1 204 392 2.0E-16
sp|P54812|TERA2_CAEEL Transitional endoplasmic reticulum ATPase homolog 2 OS=Caenorhabditis elegans GN=cdc-48.2 PE=1 SV=2 126 400 3.0E-16
sp|O28303|PAN_ARCFU Proteasome-activating nucleotidase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pan PE=1 SV=1 178 420 3.0E-16
sp|B4U7U4|FTSH_HYDS0 ATP-dependent zinc metalloprotease FtsH OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=ftsH PE=3 SV=1 171 400 3.0E-16
sp|Q7ZU99|TERA_DANRE Transitional endoplasmic reticulum ATPase OS=Danio rerio GN=vcp PE=1 SV=1 126 400 4.0E-16
sp|Q9HPF0|CDCH_HALSA Protein CdcH OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=cdcH PE=3 SV=1 198 400 4.0E-16
sp|D1C1U7|FTSH1_SPHTD ATP-dependent zinc metalloprotease FtsH 1 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH1 PE=3 SV=1 207 400 4.0E-16
sp|Q04Q03|FTSH_LEPBJ ATP-dependent zinc metalloprotease FtsH OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=ftsH PE=3 SV=1 204 412 5.0E-16
sp|Q9YAC7|PAN_AERPE Proteasome-activating nucleotidase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=pan PE=3 SV=1 188 400 8.0E-16
sp|Q96372|CDC48_CAPAN Cell division cycle protein 48 homolog OS=Capsicum annuum GN=CAFP PE=2 SV=1 133 400 1.0E-15
sp|P46463|PEX1_PICPA Peroxisome biosynthesis protein PAS1 OS=Komagataella pastoris GN=PEX1 PE=3 SV=1 209 454 1.0E-15
sp|Q8TX03|PAN_METKA Proteasome-activating nucleotidase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pan PE=3 SV=1 188 400 1.0E-15
sp|Q2FQ56|PAN_METHJ Proteasome-activating nucleotidase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pan PE=3 SV=1 177 400 1.0E-15
sp|Q9WZ49|FTSH_THEMA ATP-dependent zinc metalloprotease FtsH OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ftsH PE=1 SV=1 188 400 1.0E-15
sp|D0LWB8|FTSH_HALO1 ATP-dependent zinc metalloprotease FtsH OS=Haliangium ochraceum (strain DSM 14365 / JCM 11303 / SMP-2) GN=ftsH PE=3 SV=1 149 400 1.0E-15
sp|C7MC16|FTSH_BRAFD ATP-dependent zinc metalloprotease FtsH OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=ftsH PE=3 SV=1 204 400 1.0E-15
sp|P54774|CDC48_SOYBN Cell division cycle protein 48 homolog OS=Glycine max GN=CDC48 PE=2 SV=1 133 400 2.0E-15
sp|Q8RY16|PEX6_ARATH Peroxisome biogenesis protein 6 OS=Arabidopsis thaliana GN=PEX6 PE=1 SV=1 188 473 2.0E-15
sp|P49825|FTSH_ODOSI ATP-dependent zinc metalloprotease FtsH OS=Odontella sinensis GN=ftsH PE=3 SV=1 204 400 2.0E-15
sp|Q655S1|FTSH2_ORYSJ ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH2 PE=3 SV=1 170 400 2.0E-15
sp|O80860|FTSH2_ARATH ATP-dependent zinc metalloprotease FTSH 2, chloroplastic OS=Arabidopsis thaliana GN=FTSH2 PE=1 SV=1 170 400 2.0E-15
sp|Q9SCN8|CD48D_ARATH Cell division control protein 48 homolog D OS=Arabidopsis thaliana GN=CDC48D PE=1 SV=1 133 396 3.0E-15
sp|O13764|PEX6_SCHPO Peroxisomal ATPase pex6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex6 PE=3 SV=1 207 476 3.0E-15
sp|Q8W585|FTSH8_ARATH ATP-dependent zinc metalloprotease FTSH 8, chloroplastic OS=Arabidopsis thaliana GN=FTSH8 PE=1 SV=1 170 400 3.0E-15
sp|P33760|PEX6_YEAST Peroxisomal ATPase PEX6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX6 PE=1 SV=1 207 475 4.0E-15
sp|D1CDT8|FTSH_THET1 ATP-dependent zinc metalloprotease FtsH OS=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) GN=ftsH PE=3 SV=1 204 400 4.0E-15
sp|D2QZ34|FTSH_PIRSD ATP-dependent zinc metalloprotease FtsH OS=Pirellula staleyi (strain ATCC 27377 / DSM 6068 / ICPB 4128) GN=ftsH PE=3 SV=1 207 398 4.0E-15
sp|O69076|FTSH_STRPN ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=ftsH PE=3 SV=3 188 400 4.0E-15
sp|P59652|FTSH_STRR6 ATP-dependent zinc metalloprotease FtsH OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=ftsH PE=3 SV=1 188 400 4.0E-15
sp|P63343|FTSH_SALTY ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ftsH PE=3 SV=1 204 400 5.0E-15
sp|P63344|FTSH_SALTI ATP-dependent zinc metalloprotease FtsH OS=Salmonella typhi GN=ftsH PE=3 SV=1 204 400 5.0E-15
sp|B8G4Q6|FTSH_CHLAD ATP-dependent zinc metalloprotease FtsH OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=ftsH PE=3 SV=1 207 400 5.0E-15
sp|Q3JMH0|FTSH_BURP1 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia pseudomallei (strain 1710b) GN=ftsH PE=3 SV=2 207 400 5.0E-15
sp|Q9P3A7|CDC48_SCHPO Cell division cycle protein 48 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc48 PE=1 SV=2 126 402 6.0E-15
sp|Q9FNP1|PEX1_ARATH Peroxisome biogenesis protein 1 OS=Arabidopsis thaliana GN=PEX1 PE=2 SV=2 207 400 6.0E-15
sp|B0K5A3|FTSH1_THEPX ATP-dependent zinc metalloprotease FtsH 1 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH1 PE=3 SV=1 216 400 6.0E-15
sp|P0AAI4|FTSH_SHIFL ATP-dependent zinc metalloprotease FtsH OS=Shigella flexneri GN=ftsH PE=3 SV=1 204 400 6.0E-15
sp|P0AAI3|FTSH_ECOLI ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli (strain K12) GN=ftsH PE=1 SV=1 204 400 6.0E-15
sp|Q8X9L0|FTSH_ECO57 ATP-dependent zinc metalloprotease FtsH OS=Escherichia coli O157:H7 GN=ftsH PE=3 SV=1 204 400 7.0E-15
sp|Q55700|FTSH2_SYNY3 ATP-dependent zinc metalloprotease FtsH 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH2 PE=1 SV=1 202 400 8.0E-15
sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1 207 400 9.0E-15
sp|P46468|CDAT_PLAF7 Putative cell division cycle ATPase OS=Plasmodium falciparum (isolate 3D7) GN=PF07_0047 PE=3 SV=2 188 404 1.0E-14
sp|O78516|FTSH_GUITH ATP-dependent zinc metalloprotease FtsH OS=Guillardia theta GN=ftsH PE=3 SV=1 187 400 1.0E-14
sp|P54813|YME1_CAEEL ATP-dependent zinc metalloprotease YME1 homolog OS=Caenorhabditis elegans GN=ymel-1 PE=3 SV=2 204 400 1.0E-14
sp|B1GZK7|FTSH_UNCTG ATP-dependent zinc metalloprotease FtsH OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ftsH PE=3 SV=1 204 419 1.0E-14
sp|O67077|FTSH_AQUAE ATP-dependent zinc metalloprotease FtsH OS=Aquifex aeolicus (strain VF5) GN=ftsH PE=1 SV=1 204 392 1.0E-14
sp|O82150|FTSH_TOBAC ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Nicotiana tabacum GN=FTSH PE=2 SV=2 204 411 2.0E-14
sp|Q1PDW5|FTSH6_ARATH ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Arabidopsis thaliana GN=FTSH6 PE=2 SV=1 207 400 2.0E-14
sp|A3CV35|PAN_METMJ Proteasome-activating nucleotidase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pan PE=3 SV=1 177 400 2.0E-14
sp|Q5SI82|FTSH_THET8 ATP-dependent zinc metalloprotease FtsH OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=ftsH PE=1 SV=1 204 392 2.0E-14
sp|B3DY14|FTSH2_METI4 ATP-dependent zinc metalloprotease FtsH 2 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH2 PE=3 SV=1 204 400 3.0E-14
sp|B7T1V0|FTSH_VAULI ATP-dependent zinc metalloprotease FtsH OS=Vaucheria litorea GN=ftsH PE=3 SV=1 202 398 3.0E-14
sp|P37476|FTSH_BACSU ATP-dependent zinc metalloprotease FtsH OS=Bacillus subtilis (strain 168) GN=ftsH PE=1 SV=1 204 400 3.0E-14
sp|Q9LZF6|CD48E_ARATH Cell division control protein 48 homolog E OS=Arabidopsis thaliana GN=CDC48E PE=1 SV=2 188 400 4.0E-14
sp|Q39444|FTSH_CAPAN ATP-dependent zinc metalloprotease FTSH, chloroplastic (Fragment) OS=Capsicum annuum GN=FTSH PE=2 SV=1 204 400 4.0E-14
sp|A9EXK6|FTSH4_SORC5 ATP-dependent zinc metalloprotease FtsH 4 OS=Sorangium cellulosum (strain So ce56) GN=ftsH4 PE=3 SV=1 149 400 4.0E-14
sp|B8J992|FTSH_ANAD2 ATP-dependent zinc metalloprotease FtsH OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=ftsH PE=3 SV=1 204 400 4.0E-14
sp|P34732|SEC18_CANAX Vesicular-fusion protein SEC18 OS=Candida albicans GN=SEC18 PE=3 SV=2 169 632 4.0E-14
sp|Q0TTK8|FTSH_CLOP1 ATP-dependent zinc metalloprotease FtsH OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=ftsH PE=3 SV=1 187 415 4.0E-14
sp|C8WEG0|FTSH_ZYMMN ATP-dependent zinc metalloprotease FtsH OS=Zymomonas mobilis subsp. mobilis (strain NCIMB 11163 / B70) GN=ftsH PE=3 SV=1 204 400 4.0E-14
sp|O57940|PAN_PYRHO Proteasome-activating nucleotidase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pan PE=3 SV=1 177 411 5.0E-14
sp|C5A6P8|PAN_THEGJ Proteasome-activating nucleotidase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pan PE=3 SV=1 188 400 5.0E-14
sp|D1J722|FTSH_ECTSI ATP-dependent zinc metalloprotease FtsH OS=Ectocarpus siliculosus GN=ftsH PE=3 SV=1 207 400 5.0E-14
sp|A9A916|PAN_METM6 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=pan PE=3 SV=1 164 418 6.0E-14
sp|P73179|FTSH1_SYNY3 ATP-dependent zinc metalloprotease FtsH 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH1 PE=2 SV=1 202 400 6.0E-14
sp|Q39102|FTSH1_ARATH ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Arabidopsis thaliana GN=FTSH1 PE=1 SV=2 204 411 6.0E-14
sp|Q6LUJ8|FTSH_PHOPR ATP-dependent zinc metalloprotease FtsH OS=Photobacterium profundum GN=ftsH PE=3 SV=1 204 400 6.0E-14
sp|Q6MLS7|FTSH1_BDEBA ATP-dependent zinc metalloprotease FtsH 1 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH1 PE=3 SV=1 149 400 6.0E-14
sp|D0MGU8|FTSH_RHOM4 ATP-dependent zinc metalloprotease FtsH OS=Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) GN=ftsH PE=3 SV=1 204 400 6.0E-14
sp|A0LN68|FTSH_SYNFM ATP-dependent zinc metalloprotease FtsH OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=ftsH PE=3 SV=1 204 400 6.0E-14
sp|A4G0S4|PAN_METM5 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=pan PE=3 SV=1 164 418 7.0E-14
sp|Q5Z974|FTSH1_ORYSJ ATP-dependent zinc metalloprotease FTSH 1, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH1 PE=2 SV=1 204 411 7.0E-14
sp|P71377|FTSH_HAEIN ATP-dependent zinc metalloprotease FtsH OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ftsH PE=3 SV=1 204 400 7.0E-14
sp|Q9V287|PAN_PYRAB Proteasome-activating nucleotidase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pan PE=3 SV=2 177 411 8.0E-14
sp|A8F7F7|FTSH_PSELT ATP-dependent zinc metalloprotease FtsH OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=ftsH PE=3 SV=1 157 400 8.0E-14
sp|C8W731|FTSH_ATOPD ATP-dependent zinc metalloprotease FtsH OS=Atopobium parvulum (strain ATCC 33793 / DSM 20469 / JCM 10300 / VPI 0546) GN=ftsH PE=3 SV=1 197 400 8.0E-14
sp|D3F124|FTSH1_CONWI ATP-dependent zinc metalloprotease FtsH 1 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH1 PE=3 SV=1 204 400 8.0E-14
sp|B2UE66|FTSH_RALPJ ATP-dependent zinc metalloprotease FtsH OS=Ralstonia pickettii (strain 12J) GN=ftsH PE=3 SV=1 197 419 8.0E-14
sp|Q1LLA9|FTSH_CUPMC ATP-dependent zinc metalloprotease FtsH OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=ftsH PE=3 SV=1 150 400 9.0E-14
sp|D1BLD0|FTSH_VEIPT ATP-dependent zinc metalloprotease FtsH OS=Veillonella parvula (strain ATCC 10790 / DSM 2008 / JCM 12972 / Te3) GN=ftsH PE=3 SV=1 204 393 9.0E-14
sp|P54609|CD48A_ARATH Cell division control protein 48 homolog A OS=Arabidopsis thaliana GN=CDC48A PE=1 SV=1 177 400 1.0E-13
sp|A6VHR1|PAN_METM7 Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=pan PE=3 SV=1 164 418 1.0E-13
sp|B9KXV3|FTSH1_THERP ATP-dependent zinc metalloprotease FtsH 1 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH1 PE=3 SV=1 207 400 1.0E-13
sp|B8H444|FTSH_CAUCN ATP-dependent zinc metalloprotease FtsH OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=ftsH PE=2 SV=1 204 400 1.0E-13
sp|P51327|FTSH_PORPU ATP-dependent zinc metalloprotease FtsH OS=Porphyra purpurea GN=ftsH PE=3 SV=1 202 400 1.0E-13
sp|P48601|PRS4_DROME 26S protease regulatory subunit 4 OS=Drosophila melanogaster GN=Rpt2 PE=1 SV=2 204 411 1.0E-13
sp|D1C8C0|FTSH4_SPHTD ATP-dependent zinc metalloprotease FtsH 4 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsh4 PE=3 SV=1 171 400 1.0E-13
sp|P46466|PRS4_ORYSJ 26S protease regulatory subunit 4 homolog OS=Oryza sativa subsp. japonica GN=TBP2 PE=2 SV=2 195 400 1.0E-13
sp|Q9SL67|PRS4B_ARATH 26S proteasome regulatory subunit 4 homolog B OS=Arabidopsis thaliana GN=RPT2B PE=1 SV=1 180 400 1.0E-13
sp|Q3UMC0|SPAT5_MOUSE Spermatogenesis-associated protein 5 OS=Mus musculus GN=Spata5 PE=1 SV=2 188 400 2.0E-13
sp|Q5JHS5|PAN_THEKO Proteasome-activating nucleotidase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pan PE=3 SV=1 188 400 2.0E-13
sp|Q67T82|FTSH2_SYMTH ATP-dependent zinc metalloprotease FtsH 2 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH2 PE=3 SV=1 204 400 2.0E-13
sp|Q2JNP0|FTSH_SYNJB ATP-dependent zinc metalloprotease FtsH OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=ftsH PE=3 SV=1 204 400 2.0E-13
sp|Q9FH02|FTSH5_ARATH ATP-dependent zinc metalloprotease FTSH 5, chloroplastic OS=Arabidopsis thaliana GN=FTSH5 PE=1 SV=1 204 411 2.0E-13
sp|A0PXM8|FTSH_CLONN ATP-dependent zinc metalloprotease FtsH OS=Clostridium novyi (strain NT) GN=ftsH PE=3 SV=1 204 412 2.0E-13
sp|Q9CD58|FTSH_MYCLE ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium leprae (strain TN) GN=ftsH PE=3 SV=1 31 400 2.0E-13
sp|P73437|FTSH4_SYNY3 ATP-dependent zinc metalloprotease FtsH 4 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ftsH4 PE=2 SV=1 207 400 2.0E-13
sp|Q2SF13|FTSH_HAHCH ATP-dependent zinc metalloprotease FtsH OS=Hahella chejuensis (strain KCTC 2396) GN=ftsH PE=3 SV=1 150 413 2.0E-13
sp|B1AI94|FTSH_UREP2 ATP-dependent zinc metalloprotease FtsH OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=ftsH PE=3 SV=1 204 400 3.0E-13
sp|Q6LWR0|PAN_METMP Proteasome-activating nucleotidase OS=Methanococcus maripaludis (strain S2 / LL) GN=pan PE=3 SV=1 164 418 3.0E-13
sp|Q9BAE0|FTSH_MEDSA ATP-dependent zinc metalloprotease FTSH, chloroplastic OS=Medicago sativa GN=FTSH PE=2 SV=1 204 400 3.0E-13
sp|A6TWP7|FTSH2_ALKMQ ATP-dependent zinc metalloprotease FtsH 2 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH2 PE=3 SV=1 204 400 3.0E-13
sp|Q8U4H3|PAN_PYRFU Proteasome-activating nucleotidase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pan PE=1 SV=1 177 411 4.0E-13
sp|B6YXR2|PAN_THEON Proteasome-activating nucleotidase OS=Thermococcus onnurineus (strain NA1) GN=pan PE=3 SV=1 177 400 4.0E-13
sp|D4GUJ7|PAN1_HALVD Proteasome-activating nucleotidase 1 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan1 PE=1 SV=2 176 400 4.0E-13
sp|Q10ZF7|FTSH_TRIEI ATP-dependent zinc metalloprotease FtsH OS=Trichodesmium erythraeum (strain IMS101) GN=ftsH PE=3 SV=1 174 400 4.0E-13
sp|B9L3S8|FTSH2_THERP ATP-dependent zinc metalloprotease FtsH 2 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=ftsH2 PE=3 SV=1 175 400 4.0E-13
sp|A6LD25|FTSH_PARD8 ATP-dependent zinc metalloprotease FtsH OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ftsH PE=3 SV=1 204 454 4.0E-13
sp|D3FFN2|FTSH_MYCGH ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma gallisepticum (strain R(high / passage 156)) GN=ftsH PE=3 SV=1 207 453 4.0E-13
sp|Q8SR13|PRS6A_ENCCU 26S protease regulatory subunit 6A OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT5 PE=1 SV=1 188 388 4.0E-13
sp|O80983|FTSH4_ARATH ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Arabidopsis thaliana GN=FTSH4 PE=1 SV=2 204 400 4.0E-13
sp|P9WQN2|FTSH_MYCTO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ftsH PE=3 SV=1 67 400 5.0E-13
sp|P9WQN3|FTSH_MYCTU ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsH PE=1 SV=1 67 400 5.0E-13
sp|A5U8T5|FTSH_MYCTA ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsH PE=3 SV=1 67 400 5.0E-13
sp|P0A4V9|FTSH_MYCBO ATP-dependent zinc metalloprotease FtsH OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ftsH PE=3 SV=1 67 400 5.0E-13
sp|Q1AV13|FTSH_RUBXD ATP-dependent zinc metalloprotease FtsH OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=ftsH PE=3 SV=1 204 412 5.0E-13
sp|Q6FW67|PEX6_CANGA Peroxisomal biogenesis factor 6 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PEX6 PE=3 SV=1 207 411 6.0E-13
sp|O17071|PRS10_CAEEL Probable 26S protease regulatory subunit 10B OS=Caenorhabditis elegans GN=rpt-4 PE=1 SV=2 140 400 6.0E-13
sp|D1C2C6|FTSH2_SPHTD ATP-dependent zinc metalloprotease FtsH 2 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH2 PE=3 SV=1 180 400 6.0E-13
sp|B8I4B9|FTSH_CLOCE ATP-dependent zinc metalloprotease FtsH OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=ftsH PE=3 SV=1 216 400 6.0E-13
sp|P75120|FTSH_MYCPN ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=ftsH PE=3 SV=1 204 400 6.0E-13
sp|C7N1I1|FTSH_SLAHD ATP-dependent zinc metalloprotease FtsH OS=Slackia heliotrinireducens (strain ATCC 29202 / DSM 20476 / NCTC 11029 / RHS 1) GN=ftsH PE=3 SV=1 171 400 6.0E-13
sp|Q1D491|FTSH_MYXXD ATP-dependent zinc metalloprotease FtsH OS=Myxococcus xanthus (strain DK 1622) GN=ftsH PE=3 SV=1 149 412 6.0E-13
sp|Q8YMZ8|FTSH_NOSS1 ATP-dependent zinc metalloprotease FtsH OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=ftsH PE=3 SV=1 174 400 7.0E-13
sp|A8ZNZ4|FTSH_ACAM1 ATP-dependent zinc metalloprotease FtsH OS=Acaryochloris marina (strain MBIC 11017) GN=ftsH PE=3 SV=1 188 400 7.0E-13
sp|Q6M2F0|FTSH_CORGL ATP-dependent zinc metalloprotease FtsH OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ftsH PE=3 SV=1 188 400 7.0E-13
sp|Q980M1|PAN_SULSO Proteasome-activating nucleotidase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pan PE=3 SV=1 177 400 8.0E-13
sp|A1URA3|FTSH_BARBK ATP-dependent zinc metalloprotease FtsH OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=ftsH PE=3 SV=1 204 400 9.0E-13
sp|O74941|PEX1_SCHPO Peroxisomal ATPase pex1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pex1 PE=3 SV=1 216 494 1.0E-12
sp|Q5UT56|PAN2_HALVD Proteasome-activating nucleotidase 2 OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=pan2 PE=2 SV=1 188 400 1.0E-12
sp|Q1XDF9|FTSH_PYRYE ATP-dependent zinc metalloprotease FtsH OS=Pyropia yezoensis GN=ftsH PE=3 SV=1 202 400 1.0E-12
sp|Q8K9G8|FTSH_BUCAP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ftsH PE=3 SV=1 184 400 1.0E-12
sp|P57462|FTSH_BUCAI ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ftsH PE=3 SV=2 184 419 1.0E-12
sp|Q3B6R3|FTSH_CHLL7 ATP-dependent zinc metalloprotease FtsH OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ftsH PE=3 SV=1 204 388 1.0E-12
sp|Q9FIM2|FTSH9_ARATH ATP-dependent zinc metalloprotease FTSH 9, chloroplastic OS=Arabidopsis thaliana GN=FTSH9 PE=2 SV=1 204 415 1.0E-12
sp|Q07844|RIX7_YEAST Ribosome biogenesis ATPase RIX7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIX7 PE=1 SV=1 207 473 2.0E-12
sp|C7M0M0|FTSH_ACIFD ATP-dependent zinc metalloprotease FtsH OS=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) GN=ftsH PE=3 SV=1 204 400 2.0E-12
sp|O74445|PRS10_SCHPO Probable 26S protease subunit rpt4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt4 PE=3 SV=2 177 400 2.0E-12
sp|Q4L3G8|FTSH_STAHJ ATP-dependent zinc metalloprotease FtsH OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ftsH PE=3 SV=1 204 400 2.0E-12
sp|P47695|FTSH_MYCGE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=ftsH PE=3 SV=1 204 400 2.0E-12
sp|A2SHH9|FTSH_METPP ATP-dependent zinc metalloprotease FtsH OS=Methylibium petroleiphilum (strain PM1) GN=ftsH PE=3 SV=1 204 400 2.0E-12
sp|Q9SEX2|KTNA1_ARATH Katanin p60 ATPase-containing subunit A1 OS=Arabidopsis thaliana GN=AAA1 PE=1 SV=1 215 400 2.0E-12
sp|A6UQT3|PAN_METVS Proteasome-activating nucleotidase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=pan PE=3 SV=1 164 400 3.0E-12
sp|Q8EUA6|FTSH_MYCPE ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma penetrans (strain HF-2) GN=ftsH PE=3 SV=1 207 400 3.0E-12
sp|O26824|PAN_METTH Proteasome-activating nucleotidase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pan PE=3 SV=1 188 400 4.0E-12
sp|P53549|PRS10_YEAST 26S protease subunit RPT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT4 PE=1 SV=4 188 400 4.0E-12
sp|Q2LUQ1|FTSH_SYNAS ATP-dependent zinc metalloprotease FtsH OS=Syntrophus aciditrophicus (strain SB) GN=ftsH PE=3 SV=1 204 400 4.0E-12
sp|A0LR74|FTSH_ACIC1 ATP-dependent zinc metalloprotease FtsH OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=ftsH PE=3 SV=1 204 398 4.0E-12
sp|A6QBN8|FTSH_SULNB ATP-dependent zinc metalloprotease FtsH OS=Sulfurovum sp. (strain NBC37-1) GN=ftsH PE=3 SV=1 207 453 4.0E-12
sp|Q8SSJ5|CDC48_ENCCU Cell division control protein 48 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CDC48 PE=1 SV=1 158 400 5.0E-12
sp|C3NFW6|PAN_SULIN Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=pan PE=3 SV=1 177 400 5.0E-12
sp|C3N7K8|PAN_SULIY Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=pan PE=3 SV=1 177 400 5.0E-12
sp|C3MY47|PAN_SULIM Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=pan PE=3 SV=1 177 400 5.0E-12
sp|C3MRF1|PAN_SULIL Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=pan PE=3 SV=1 177 400 5.0E-12
sp|C4KIR6|PAN_SULIK Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=pan PE=3 SV=1 177 400 5.0E-12
sp|C3MZI6|PAN_SULIA Proteasome-activating nucleotidase OS=Sulfolobus islandicus (strain M.16.27) GN=pan PE=3 SV=1 177 400 5.0E-12
sp|Q9TJ83|FTSH_CYAME ATP-dependent zinc metalloprotease FtsH OS=Cyanidioschyzon merolae GN=ftsH PE=3 SV=1 204 400 5.0E-12
sp|D1C4U5|FTSH3_SPHTD ATP-dependent zinc metalloprotease FtsH 3 OS=Sphaerobacter thermophilus (strain DSM 20745 / S 6022) GN=ftsH3 PE=3 SV=1 202 400 5.0E-12
sp|A9NE17|FTSH_ACHLI ATP-dependent zinc metalloprotease FtsH OS=Acholeplasma laidlawii (strain PG-8A) GN=ftsH PE=3 SV=1 204 393 5.0E-12
sp|Q55BV5|PRS4_DICDI 26S protease regulatory subunit 4 homolog OS=Dictyostelium discoideum GN=psmC1 PE=1 SV=1 180 409 5.0E-12
sp|Q8LQJ9|FTSH4_ORYSJ ATP-dependent zinc metalloprotease FTSH 4, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH4 PE=3 SV=1 204 400 5.0E-12
sp|P32794|AFG2_YEAST ATPase family gene 2 protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AFG2 PE=1 SV=1 218 420 6.0E-12
sp|Q0W257|PAN_METAR Proteasome-activating nucleotidase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=pan PE=3 SV=1 185 400 6.0E-12
sp|Q8TI88|PAN_METAC Proteasome-activating nucleotidase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pan PE=3 SV=2 188 400 6.0E-12
sp|Q5RII9|KTNA1_DANRE Katanin p60 ATPase-containing subunit A1 OS=Danio rerio GN=katna1 PE=2 SV=1 207 473 6.0E-12
sp|Q6F0E5|FTSH_MESFL ATP-dependent zinc metalloprotease FtsH OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=ftsH PE=3 SV=1 207 413 6.0E-12
sp|B2XTF7|FTSH_HETA2 ATP-dependent zinc metalloprotease FtsH OS=Heterosigma akashiwo (strain NIES-293) GN=ftsH PE=3 SV=1 202 400 7.0E-12
sp|B5X3X5|KTNA1_SALSA Katanin p60 ATPase-containing subunit A1 OS=Salmo salar GN=katna1 PE=2 SV=1 207 473 7.0E-12
sp|Q9WV86|KTNA1_MOUSE Katanin p60 ATPase-containing subunit A1 OS=Mus musculus GN=Katna1 PE=1 SV=1 207 473 7.0E-12
sp|A9GRC9|FTSH1_SORC5 ATP-dependent zinc metalloprotease FtsH 1 OS=Sorangium cellulosum (strain So ce56) GN=ftsH1 PE=3 SV=1 204 399 8.0E-12
sp|Q8NB90|SPAT5_HUMAN Spermatogenesis-associated protein 5 OS=Homo sapiens GN=SPATA5 PE=1 SV=3 188 400 9.0E-12
sp|C6V4R9|FTSH_NEORI ATP-dependent zinc metalloprotease FtsH OS=Neorickettsia risticii (strain Illinois) GN=ftsH PE=3 SV=1 206 400 1.0E-11
sp|B2JVU2|FTSH_BURP8 ATP-dependent zinc metalloprotease FtsH OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=ftsH PE=3 SV=1 204 400 1.0E-11
sp|A0L4S0|FTSH_MAGMM ATP-dependent zinc metalloprotease FtsH OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=ftsH PE=3 SV=1 204 400 1.0E-11
sp|Q9HGM3|YTA12_SCHPO Mitochondrial respiratory chain complexes assembly protein rca1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yta12 PE=3 SV=1 163 396 1.0E-11
sp|P46465|PRS6A_ORYSJ 26S protease regulatory subunit 6A homolog OS=Oryza sativa subsp. japonica GN=TBP1 PE=2 SV=2 178 400 1.0E-11
sp|Q67WJ2|FTSH6_ORYSJ ATP-dependent zinc metalloprotease FTSH 6, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH6 PE=3 SV=1 207 400 1.0E-11
sp|Q8PY58|PAN_METMA Proteasome-activating nucleotidase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pan PE=3 SV=1 188 400 2.0E-11
sp|P46508|YME1_SCHMA ATP-dependent zinc metalloprotease YME1 homolog OS=Schistosoma mansoni PE=2 SV=1 188 422 2.0E-11
sp|Q9M895|FTSI3_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 3, chloroplastic OS=Arabidopsis thaliana GN=FTSHI3 PE=1 SV=1 210 400 2.0E-11
sp|Q3JEE4|FTSH_NITOC ATP-dependent zinc metalloprotease FtsH OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=ftsH PE=3 SV=1 204 400 2.0E-11
sp|A5W382|FTSH_PSEP1 ATP-dependent zinc metalloprotease FtsH OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=ftsH PE=3 SV=1 174 400 2.0E-11
sp|Q1HGK7|KTNA1_CHICK Katanin p60 ATPase-containing subunit A1 OS=Gallus gallus GN=KATNA1 PE=2 SV=1 207 473 2.0E-11
sp|B2A3Q4|FTSH_NATTJ ATP-dependent zinc metalloprotease FtsH OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=ftsH PE=3 SV=1 204 400 2.0E-11
sp|Q6E0V2|KTNA1_RAT Katanin p60 ATPase-containing subunit A1 OS=Rattus norvegicus GN=Katna1 PE=1 SV=1 207 473 2.0E-11
sp|Q9SD67|FTSH7_ARATH ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Arabidopsis thaliana GN=FTSH7 PE=2 SV=1 204 400 2.0E-11
sp|Q8LQJ8|FTSH5_ORYSJ ATP-dependent zinc metalloprotease FTSH 5, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH5 PE=3 SV=1 204 400 2.0E-11
sp|O22993|FTSI1_ARATH Probable inactive ATP-dependent zinc metalloprotease FTSHI 1, chloroplastic OS=Arabidopsis thaliana GN=FTSHI1 PE=1 SV=1 194 400 2.0E-11
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 216 400 3.0E-11
sp|Q67JH0|FTSH3_SYMTH ATP-dependent zinc metalloprotease FtsH 3 OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=ftsH3 PE=3 SV=1 204 400 3.0E-11
sp|B8D065|FTSH_HALOH ATP-dependent zinc metalloprotease FtsH OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=ftsH PE=3 SV=1 204 400 3.0E-11
sp|C0ZPK5|FTSH_RHOE4 ATP-dependent zinc metalloprotease FtsH OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ftsH PE=3 SV=1 204 400 3.0E-11
sp|Q9SEI2|PS6AA_ARATH 26S protease regulatory subunit 6A homolog A OS=Arabidopsis thaliana GN=RPT5A PE=1 SV=1 178 400 3.0E-11
sp|O23894|PRS6A_BRACM 26S protease regulatory subunit 6A homolog OS=Brassica campestris GN=TBP1 PE=2 SV=1 178 400 3.0E-11
sp|O19922|FTSH_CYACA ATP-dependent zinc metalloprotease FtsH OS=Cyanidium caldarium GN=ftsH PE=3 SV=1 218 412 4.0E-11
sp|O16368|PRS4_CAEEL Probable 26S protease regulatory subunit 4 OS=Caenorhabditis elegans GN=rpt-2 PE=3 SV=1 188 411 4.0E-11
sp|D2NQQ7|FTSH_ROTMD ATP-dependent zinc metalloprotease FtsH OS=Rothia mucilaginosa (strain DY-18) GN=ftsH PE=3 SV=1 204 400 4.0E-11
sp|Q9SEI3|PS10A_ARATH 26S protease regulatory subunit 10B homolog A OS=Arabidopsis thaliana GN=RPT4A PE=1 SV=1 204 400 5.0E-11
sp|Q90732|PRS4_CHICK 26S protease regulatory subunit 4 OS=Gallus gallus GN=PSMC1 PE=2 SV=1 204 411 5.0E-11
sp|D4HA34|FTSH_PROAS ATP-dependent zinc metalloprotease FtsH OS=Propionibacterium acnes (strain SK137) GN=ftsH PE=3 SV=1 204 400 5.0E-11
sp|B3EX35|KATL1_SORAR Katanin p60 ATPase-containing subunit A-like 1 OS=Sorex araneus GN=KATNAL1 PE=3 SV=1 207 400 5.0E-11
sp|Q9HRW6|PAN1_HALSA Proteasome-activating nucleotidase 1 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan1 PE=3 SV=3 206 400 6.0E-11
sp|A9BJK3|FTSH3_PETMO ATP-dependent zinc metalloprotease FtsH 3 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH3 PE=3 SV=1 204 400 6.0E-11
sp|P62193|PRS4_RAT 26S protease regulatory subunit 4 OS=Rattus norvegicus GN=Psmc1 PE=2 SV=1 204 411 6.0E-11
sp|P62192|PRS4_MOUSE 26S protease regulatory subunit 4 OS=Mus musculus GN=Psmc1 PE=1 SV=1 204 411 6.0E-11
sp|P62191|PRS4_HUMAN 26S protease regulatory subunit 4 OS=Homo sapiens GN=PSMC1 PE=1 SV=1 204 411 6.0E-11
sp|Q5U3S1|KATL1_DANRE Katanin p60 ATPase-containing subunit A-like 1 OS=Danio rerio GN=katnal1 PE=2 SV=1 207 473 6.0E-11
sp|F4IAE9|Y1591_ARATH ATPase family AAA domain-containing protein At1g05910 OS=Arabidopsis thaliana GN=At1g05910 PE=2 SV=1 188 414 7.0E-11
sp|Q89AF2|FTSH_BUCBP ATP-dependent zinc metalloprotease FtsH OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ftsH PE=3 SV=1 204 400 7.0E-11
sp|B3QZS3|FTSH2_PHYMT ATP-dependent zinc metalloprotease FtsH 2 OS=Phytoplasma mali (strain AT) GN=ftsH2 PE=3 SV=1 197 398 7.0E-11
sp|Q6MJV1|FTSH2_BDEBA ATP-dependent zinc metalloprotease FtsH 2 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=ftsH2 PE=3 SV=1 204 454 8.0E-11
sp|A9KIG5|FTSH_CLOPH ATP-dependent zinc metalloprotease FtsH OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=ftsH PE=3 SV=1 206 404 8.0E-11
sp|B3R057|FTSH1_PHYMT ATP-dependent zinc metalloprotease FtsH 1 OS=Phytoplasma mali (strain AT) GN=ftsH1 PE=3 SV=1 201 400 8.0E-11
sp|Q60AK1|FTSH_METCA ATP-dependent zinc metalloprotease FtsH OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ftsH PE=3 SV=1 171 393 8.0E-11
sp|P54776|PRS6A_SOLLC 26S protease regulatory subunit 6A homolog OS=Solanum lycopersicum GN=TBP1 PE=2 SV=1 188 400 9.0E-11
sp|P32795|YME1_YEAST Mitochondrial inner membrane i-AAA protease supercomplex subunit YME1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YME1 PE=1 SV=1 204 539 1.0E-10
sp|C1F8X6|FTSH_ACIC5 ATP-dependent zinc metalloprotease FtsH OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=ftsH PE=3 SV=1 216 398 1.0E-10
sp|Q83FV7|FTSH_TROWT ATP-dependent zinc metalloprotease FtsH OS=Tropheryma whipplei (strain Twist) GN=ftsH PE=3 SV=1 204 400 1.0E-10
sp|P40327|PRS4_YEAST 26S protease regulatory subunit 4 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT2 PE=1 SV=3 180 400 1.0E-10
sp|Q6H6R9|FTSH7_ORYSJ ATP-dependent zinc metalloprotease FTSH 7, chloroplastic OS=Oryza sativa subsp. japonica GN=FTSH7 PE=3 SV=1 204 400 1.0E-10
sp|O60058|AFG2_SCHPO ATPase family gene 2 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=afg2 PE=3 SV=1 155 400 2.0E-10
sp|Q6CPV1|PEX6_KLULA Peroxisomal biogenesis factor 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PEX6 PE=3 SV=1 188 411 2.0E-10
sp|Q8CDM1|ATAD2_MOUSE ATPase family AAA domain-containing protein 2 OS=Mus musculus GN=Atad2 PE=1 SV=1 204 589 2.0E-10
sp|Q6MDI5|FTSH_PARUW ATP-dependent zinc metalloprotease FtsH OS=Protochlamydia amoebophila (strain UWE25) GN=ftsH PE=3 SV=1 204 400 2.0E-10
sp|O75449|KTNA1_HUMAN Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens GN=KATNA1 PE=1 SV=1 207 400 2.0E-10
sp|Q4R407|KTNA1_MACFA Katanin p60 ATPase-containing subunit A1 OS=Macaca fascicularis GN=KATNA1 PE=2 SV=1 207 400 2.0E-10
sp|O04019|PS6AB_ARATH 26S protease regulatory subunit 6A homolog B OS=Arabidopsis thaliana GN=RPT5B PE=1 SV=3 178 400 2.0E-10
sp|A9FDV9|FTSH2_SORC5 ATP-dependent zinc metalloprotease FtsH 2 OS=Sorangium cellulosum (strain So ce56) GN=ftsH2 PE=3 SV=1 207 398 2.0E-10
sp|A9RA82|KATL1_PAPAN Katanin p60 ATPase-containing subunit A-like 1 OS=Papio anubis GN=KATNAL1 PE=3 SV=1 207 400 2.0E-10
sp|Q9MAK9|PS10B_ARATH 26S protease regulatory subunit S10B homolog B OS=Arabidopsis thaliana GN=RPT4B PE=1 SV=1 204 400 3.0E-10
sp|D5HA94|FTSH2_SALRM ATP-dependent zinc metalloprotease FtsH 2 OS=Salinibacter ruber (strain M8) GN=ftsH2 PE=3 SV=1 204 400 3.0E-10
sp|P54816|TBP7_CAEEL Tat-binding homolog 7 OS=Caenorhabditis elegans GN=lex-1 PE=1 SV=3 204 401 3.0E-10
sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3 204 589 4.0E-10
sp|A9BFL9|FTSH1_PETMO ATP-dependent zinc metalloprotease FtsH 1 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH1 PE=3 SV=1 204 419 4.0E-10
sp|Q920A7|AFG31_MOUSE AFG3-like protein 1 OS=Mus musculus GN=Afg3l1 PE=1 SV=2 188 400 4.0E-10
sp|Q74Z13|PEX6_ASHGO Peroxisomal biogenesis factor 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PEX6 PE=3 SV=1 207 408 6.0E-10
sp|P34124|PRS8_DICDI 26S protease regulatory subunit 8 OS=Dictyostelium discoideum GN=psmC5 PE=1 SV=2 207 400 6.0E-10
sp|B4SCV5|FTSH_PELPB ATP-dependent zinc metalloprotease FtsH OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ftsH PE=3 SV=1 204 400 6.0E-10
sp|B3DV46|FTSH1_METI4 ATP-dependent zinc metalloprotease FtsH 1 OS=Methylacidiphilum infernorum (isolate V4) GN=ftsH1 PE=3 SV=1 204 392 7.0E-10
sp|Q9LET7|CI111_ARATH Calmodulin-interacting protein 111 OS=Arabidopsis thaliana GN=CIP111 PE=1 SV=1 188 400 8.0E-10
sp|Q975U2|PAN_SULTO Proteasome-activating nucleotidase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pan PE=3 SV=2 204 400 8.0E-10
sp|P28737|MSP1_YEAST Protein MSP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSP1 PE=1 SV=2 188 413 8.0E-10
sp|O83746|FTSH_TREPA ATP-dependent zinc metalloprotease FtsH OS=Treponema pallidum (strain Nichols) GN=ftsH PE=3 SV=1 207 400 8.0E-10
sp|O18413|PRS8_DROME 26S protease regulatory subunit 8 OS=Drosophila melanogaster GN=Rpt6 PE=1 SV=2 207 411 9.0E-10
sp|Q54PJ1|PRS10_DICDI 26S protease regulatory subunit 10B OS=Dictyostelium discoideum GN=psmC6 PE=1 SV=1 204 400 9.0E-10
sp|A8X0L9|TBP7_CAEBR Tat-binding homolog 7 OS=Caenorhabditis briggsae GN=lex-1 PE=3 SV=2 204 401 9.0E-10
sp|P54814|PRS8_MANSE 26S protease regulatory subunit 8 OS=Manduca sexta PE=2 SV=1 207 411 1.0E-09
sp|Q25544|PRS8_NAEFO 26S protease regulatory subunit 8 homolog OS=Naegleria fowleri PE=2 SV=1 207 411 1.0E-09
sp|B0K657|FTSH2_THEPX ATP-dependent zinc metalloprotease FtsH 2 OS=Thermoanaerobacter sp. (strain X514) GN=ftsH2 PE=3 SV=1 188 429 1.0E-09
sp|P18759|SEC18_YEAST Vesicular-fusion protein SEC18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC18 PE=1 SV=2 182 593 1.0E-09
sp|A1TZE0|FTSH_MARHV ATP-dependent zinc metalloprotease FtsH OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ftsH PE=3 SV=1 204 400 1.0E-09
sp|Q2NIN5|FTSH_AYWBP ATP-dependent zinc metalloprotease FtsH OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=ftsH PE=3 SV=1 166 393 1.0E-09
sp|Q9UQ90|SPG7_HUMAN Paraplegin OS=Homo sapiens GN=SPG7 PE=1 SV=2 193 400 1.0E-09
sp|Q9PUL2|KTNA1_XENLA Katanin p60 ATPase-containing subunit A1 (Fragment) OS=Xenopus laevis GN=katna1 PE=2 SV=1 207 473 1.0E-09
sp|Q0IIR9|KTNA1_XENTR Katanin p60 ATPase-containing subunit A1 OS=Xenopus tropicalis GN=katna1 PE=2 SV=1 207 473 1.0E-09
sp|Q9HG03|PEX6_PENCH Peroxisomal biogenesis factor 6 OS=Penicillium chrysogenum GN=pex6 PE=3 SV=1 207 407 2.0E-09
sp|P46470|PRS8_XENLA 26S protease regulatory subunit 8 OS=Xenopus laevis GN=psmc5 PE=2 SV=2 207 411 2.0E-09
sp|Q8SRH0|PRS4_ENCCU 26S protease regulatory subunit 4 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT2 PE=1 SV=1 188 400 2.0E-09
sp|Q0DHL4|FTSH8_ORYSJ ATP-dependent zinc metalloprotease FTSH 8, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH8 PE=3 SV=1 204 419 2.0E-09
sp|Q3A579|FTSH_PELCD ATP-dependent zinc metalloprotease FtsH OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ftsH PE=3 SV=1 204 400 2.0E-09
sp|Q3ULF4|SPG7_MOUSE Paraplegin OS=Mus musculus GN=Spg7 PE=1 SV=1 193 400 2.0E-09
sp|B3R0R7|FTSH3_PHYMT ATP-dependent zinc metalloprotease FtsH 3 OS=Phytoplasma mali (strain AT) GN=ftsH3 PE=3 SV=1 202 400 2.0E-09
sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1 204 400 3.0E-09
sp|Q8SQI9|PRS6B_ENCCU 26S protease regulatory subunit 6B homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU08_1970 PE=1 SV=1 204 400 3.0E-09
sp|A9BHD3|FTSH2_PETMO ATP-dependent zinc metalloprotease FtsH 2 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=ftsH2 PE=3 SV=1 204 400 3.0E-09
sp|B7J0N5|FTSH_BORBZ ATP-dependent zinc metalloprotease FtsH OS=Borrelia burgdorferi (strain ZS7) GN=ftsH PE=3 SV=1 144 398 3.0E-09
sp|Q9C5U3|PRS8A_ARATH 26S protease regulatory subunit 8 homolog A OS=Arabidopsis thaliana GN=RPT6A PE=1 SV=1 207 411 4.0E-09
sp|Q94BQ2|PRS8B_ARATH 26S protease regulatory subunit 8 homolog B OS=Arabidopsis thaliana GN=RPT6B PE=1 SV=1 207 411 4.0E-09
sp|C7PVU9|ARC_CATAD Proteasome-associated ATPase OS=Catenulispora acidiphila (strain DSM 44928 / NRRL B-24433 / NBRC 102108 / JCM 14897) GN=arc PE=3 SV=1 187 411 5.0E-09
sp|Q9HNP9|PAN2_HALSA Proteasome-activating nucleotidase 2 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pan2 PE=3 SV=1 188 400 5.0E-09
sp|Q2KIW6|PRS10_BOVIN 26S protease regulatory subunit 10B OS=Bos taurus GN=PSMC6 PE=2 SV=1 175 400 5.0E-09
sp|P62334|PRS10_MOUSE 26S protease regulatory subunit 10B OS=Mus musculus GN=Psmc6 PE=1 SV=1 175 400 5.0E-09
sp|P62335|PRS10_ICTTR 26S protease regulatory subunit 10B OS=Ictidomys tridecemlineatus GN=PSMC6 PE=2 SV=1 175 400 5.0E-09
sp|P62333|PRS10_HUMAN 26S protease regulatory subunit 10B OS=Homo sapiens GN=PSMC6 PE=1 SV=1 175 400 5.0E-09
sp|Q5RDX4|ATAD2_PONAB ATPase family AAA domain-containing protein 2 OS=Pongo abelii GN=ATAD2 PE=2 SV=1 204 400 6.0E-09
sp|Q6KHA4|FTSH_MYCMO ATP-dependent zinc metalloprotease FtsH OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ftsH PE=3 SV=1 204 400 6.0E-09
sp|P40340|TBP7_YEAST Tat-binding homolog 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTA7 PE=1 SV=2 204 400 7.0E-09
sp|O14114|YEJJ_SCHPO Uncharacterized AAA domain-containing protein C31G5.19 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC31G5.19 PE=3 SV=1 183 593 7.0E-09
sp|P62198|PRS8_RAT 26S protease regulatory subunit 8 OS=Rattus norvegicus GN=Psmc5 PE=1 SV=1 207 411 8.0E-09
sp|P62197|PRS8_PIG 26S protease regulatory subunit 8 OS=Sus scrofa GN=PSMC5 PE=2 SV=1 207 411 8.0E-09
sp|P62196|PRS8_MOUSE 26S protease regulatory subunit 8 OS=Mus musculus GN=Psmc5 PE=1 SV=1 207 411 8.0E-09
sp|P62195|PRS8_HUMAN 26S protease regulatory subunit 8 OS=Homo sapiens GN=PSMC5 PE=1 SV=1 207 411 8.0E-09
sp|P62194|PRS8_BOVIN 26S protease regulatory subunit 8 OS=Bos taurus GN=PSMC5 PE=2 SV=1 207 411 8.0E-09
sp|C5CES8|FTSH_KOSOT ATP-dependent zinc metalloprotease FtsH OS=Kosmotoga olearia (strain TBF 19.5.1) GN=ftsH PE=3 SV=1 188 400 8.0E-09
sp|Q9RJ58|ARC_STRCO Proteasome-associated ATPase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=arc PE=3 SV=1 207 380 9.0E-09
sp|B0B970|FTSH_CHLT2 ATP-dependent zinc metalloprotease FtsH OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=ftsH PE=3 SV=1 204 392 9.0E-09
sp|Q7UUZ7|FTSH1_RHOBA ATP-dependent zinc metalloprotease FtsH 1 OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=ftsH1 PE=3 SV=1 204 400 9.0E-09
sp|Q6BS73|PEX6_DEBHA Peroxisomal biogenesis factor 6 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PEX6 PE=3 SV=2 188 476 1.0E-08
sp|C4LIL2|ARC_CORK4 AAA ATPase forming ring-shaped complexes OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=arc PE=3 SV=2 207 391 1.0E-08
sp|Q828J2|ARC_STRAW Proteasome-associated ATPase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=arc PE=3 SV=1 207 409 1.0E-08
sp|P46507|PRS6B_MANSE 26S protease regulatory subunit 6B OS=Manduca sexta PE=2 SV=1 208 438 1.0E-08
sp|B1ZMG6|FTSH_OPITP ATP-dependent zinc metalloprotease FtsH OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=ftsH PE=3 SV=1 204 407 1.0E-08
sp|P33297|PRS6A_YEAST 26S protease regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT5 PE=1 SV=3 178 400 1.0E-08
sp|Q9UVU5|PEX6_PICAN Peroxisomal biogenesis factor 6 OS=Pichia angusta GN=PEX6 PE=1 SV=1 207 407 2.0E-08
sp|B8GGN4|PAN_METPE Proteasome-activating nucleotidase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pan PE=3 SV=1 177 400 2.0E-08
sp|Q9M0Y8|NSF_ARATH Vesicle-fusing ATPase OS=Arabidopsis thaliana GN=NSF PE=2 SV=2 182 593 2.0E-08
sp|P34123|PRS6B_DICDI 26S protease regulatory subunit 6B homolog OS=Dictyostelium discoideum GN=psmC4 PE=1 SV=1 178 378 2.0E-08
sp|Q8JZQ2|AFG32_MOUSE AFG3-like protein 2 OS=Mus musculus GN=Afg3l2 PE=1 SV=1 188 400 2.0E-08
sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2 188 400 2.0E-08
sp|D5H7Z5|FTSH1_SALRM ATP-dependent zinc metalloprotease FtsH 1 OS=Salinibacter ruber (strain M8) GN=ftsH1 PE=3 SV=1 218 440 2.0E-08
sp|Q01939|PRS8_YEAST 26S protease regulatory subunit 8 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT6 PE=1 SV=4 207 411 3.0E-08
sp|A6TSZ1|FTSH1_ALKMQ ATP-dependent zinc metalloprotease FtsH 1 OS=Alkaliphilus metalliredigens (strain QYMF) GN=ftsH1 PE=3 SV=1 204 400 3.0E-08
sp|D3FA80|FTSH2_CONWI ATP-dependent zinc metalloprotease FtsH 2 OS=Conexibacter woesei (strain DSM 14684 / JCM 11494 / NBRC 100937 / ID131577) GN=ftsH2 PE=3 SV=1 204 400 3.0E-08
sp|Q9SEI4|PRS6B_ARATH 26S protease regulatory subunit 6B homolog OS=Arabidopsis thaliana GN=RPT3 PE=1 SV=1 204 400 4.0E-08
sp|Q8S2A7|FTSH3_ORYSJ ATP-dependent zinc metalloprotease FTSH 3, mitochondrial OS=Oryza sativa subsp. japonica GN=FTSH3 PE=3 SV=1 204 400 4.0E-08
sp|Q18787|PRS7_CAEEL 26S protease regulatory subunit 7 OS=Caenorhabditis elegans GN=rpt-1 PE=1 SV=1 166 400 5.0E-08
sp|P85200|PRS6B_HELAN 26S protease regulatory subunit 6B homolog OS=Helianthus annuus PE=1 SV=1 217 400 5.0E-08
sp|Q4R7L3|PRS6B_MACFA 26S protease regulatory subunit 6B OS=Macaca fascicularis GN=PSMC4 PE=2 SV=1 208 378 5.0E-08
sp|P43686|PRS6B_HUMAN 26S protease regulatory subunit 6B OS=Homo sapiens GN=PSMC4 PE=1 SV=2 208 378 5.0E-08
sp|Q3T030|PRS6B_BOVIN 26S protease regulatory subunit 6B OS=Bos taurus GN=PSMC4 PE=2 SV=1 208 378 5.0E-08
sp|P54778|PRS6B_SOLTU 26S protease regulatory subunit 6B homolog OS=Solanum tuberosum PE=2 SV=1 208 400 5.0E-08
sp|Q63570|PRS6B_RAT 26S protease regulatory subunit 6B OS=Rattus norvegicus GN=Psmc4 PE=1 SV=1 208 378 6.0E-08
sp|P54775|PRS6B_MOUSE 26S protease regulatory subunit 6B OS=Mus musculus GN=Psmc4 PE=1 SV=2 208 378 6.0E-08
sp|Q2KJI7|AFG32_BOVIN AFG3-like protein 2 OS=Bos taurus GN=AFG3L2 PE=2 SV=1 188 400 6.0E-08
sp|Q92JJ9|FTSH_RICCN ATP-dependent zinc metalloprotease FtsH OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=ftsH PE=3 SV=1 204 456 7.0E-08
sp|C9Z319|ARC_STRSW Proteasome-associated ATPase OS=Streptomyces scabiei (strain 87.22) GN=arc PE=3 SV=2 207 403 8.0E-08
sp|Q7TT47|SPG7_RAT Paraplegin OS=Rattus norvegicus GN=Spg7 PE=2 SV=1 193 413 8.0E-08
sp|Q4UN68|FTSH_RICFE ATP-dependent zinc metalloprotease FtsH OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=ftsH PE=3 SV=1 204 456 9.0E-08
sp|Q7SGP2|PEX6_NEUCR Peroxisomal biogenesis factor 6 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pex-6 PE=3 SV=1 207 407 1.0E-07
sp|Q1B795|ARC_MYCSS Proteasome-associated ATPase OS=Mycobacterium sp. (strain MCS) GN=mpa PE=3 SV=1 204 383 1.0E-07
sp|A1UHT0|ARC_MYCSK Proteasome-associated ATPase OS=Mycobacterium sp. (strain KMS) GN=mpa PE=3 SV=1 204 383 1.0E-07
sp|A3Q196|ARC_MYCSJ Proteasome-associated ATPase OS=Mycobacterium sp. (strain JLS) GN=mpa PE=3 SV=1 204 383 1.0E-07
sp|Q8SQK0|PRS8_ENCCU 26S protease regulatory subunit 8 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPT6 PE=1 SV=2 207 411 1.0E-07
sp|P33298|PRS6B_YEAST 26S protease regulatory subunit 6B homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT3 PE=1 SV=2 204 378 1.0E-07
sp|Q68XR9|FTSH_RICTY ATP-dependent zinc metalloprotease FtsH OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=ftsH PE=3 SV=1 204 400 1.0E-07
sp|Q9ZEA2|FTSH_RICPR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia prowazekii (strain Madrid E) GN=ftsH PE=3 SV=1 204 400 1.0E-07
sp|Q1RGP0|FTSH_RICBR ATP-dependent zinc metalloprotease FtsH OS=Rickettsia bellii (strain RML369-C) GN=ftsH PE=3 SV=1 204 416 1.0E-07
sp|B2UMY1|FTSH_AKKM8 ATP-dependent zinc metalloprotease FtsH OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=ftsH PE=3 SV=1 204 400 1.0E-07
sp|P41836|PRS8_SCHPO 26S protease regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=let1 PE=3 SV=1 207 411 2.0E-07
sp|D5D8E3|FTSH_SULMD ATP-dependent zinc metalloprotease FtsH OS=Sulcia muelleri (strain DMIN) GN=ftsH PE=3 SV=1 207 400 2.0E-07
sp|Q5ZK92|SPAST_CHICK Spastin OS=Gallus gallus GN=SPAST PE=2 SV=1 205 400 2.0E-07
sp|B7PXE3|SPAST_IXOSC Spastin OS=Ixodes scapularis GN=spas PE=3 SV=1 207 400 2.0E-07
sp|Q54CS8|PEX6_DICDI Peroxisomal biogenesis factor 6 OS=Dictyostelium discoideum GN=pex6 PE=3 SV=1 219 382 3.0E-07
sp|A1TAQ3|ARC_MYCVP Proteasome-associated ATPase OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=mpa PE=3 SV=1 204 383 3.0E-07
sp|B1MAH2|ARC_MYCA9 Proteasome-associated ATPase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=mpa PE=3 SV=1 204 383 4.0E-07
sp|A4FBX6|ARC_SACEN Proteasome-associated ATPase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=arc PE=3 SV=1 204 383 4.0E-07
sp|Q9SSB4|PRS7B_ARATH 26S protease regulatory subunit 7 homolog B OS=Arabidopsis thaliana GN=RPT1B PE=1 SV=2 173 400 6.0E-07
sp|Q60QD1|FIGL1_CAEBR Fidgetin-like protein 1 OS=Caenorhabditis briggsae GN=figl-1 PE=3 SV=1 134 400 6.0E-07
sp|C8XAR0|ARC_NAKMY Proteasome-associated ATPase OS=Nakamurella multipartita (strain ATCC 700099 / DSM 44233 / JCM 9543 / Y-104) GN=arc PE=3 SV=1 204 363 7.0E-07
sp|B1W303|ARC_STRGG Proteasome-associated ATPase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=arc PE=3 SV=1 205 409 7.0E-07
sp|P78578|PRS6B_ASPNG 26S protease regulatory subunit 6B homolog OS=Aspergillus niger GN=tbpA PE=3 SV=1 208 378 7.0E-07
sp|Q09803|VPS4_SCHPO Suppressor protein of bem1/bed5 double mutants OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps4 PE=3 SV=1 207 473 7.0E-07
sp|Q5R8D7|PRS7_PONAB 26S protease regulatory subunit 7 OS=Pongo abelii GN=PSMC2 PE=2 SV=3 173 400 8.0E-07
sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2 204 406 8.0E-07
sp|A4TB65|ARC_MYCGI Proteasome-associated ATPase OS=Mycobacterium gilvum (strain PYR-GCK) GN=mpa PE=3 SV=1 204 383 1.0E-06
sp|Q6NH92|ARC_CORDI AAA ATPase forming ring-shaped complexes OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=arc PE=3 SV=1 207 363 1.0E-06
sp|Q8FTE3|ARC_COREF AAA ATPase forming ring-shaped complexes OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=arc PE=3 SV=1 204 363 1.0E-06
sp|A1SK07|ARC_NOCSJ Proteasome-associated ATPase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=arc PE=3 SV=1 205 383 1.0E-06
sp|A0LU46|ARC_ACIC1 Proteasome-associated ATPase OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=arc PE=3 SV=1 207 403 1.0E-06
sp|Q63347|PRS7_RAT 26S protease regulatory subunit 7 OS=Rattus norvegicus GN=Psmc2 PE=1 SV=3 173 400 1.0E-06
sp|Q5AG40|VPS4_CANAL Vacuolar protein sorting-associated protein 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS4 PE=2 SV=1 214 475 1.0E-06
sp|A0QZ54|ARC_MYCS2 Proteasome-associated ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=mpa PE=1 SV=1 204 383 2.0E-06
sp|A0QFB2|ARC_MYCA1 Proteasome-associated ATPase OS=Mycobacterium avium (strain 104) GN=mpa PE=3 SV=2 204 383 2.0E-06
sp|Q5YUW4|ARC_NOCFA Proteasome-associated ATPase OS=Nocardia farcinica (strain IFM 10152) GN=arc PE=3 SV=1 204 383 2.0E-06
sp|C7MWW2|ARC_SACVD Proteasome-associated ATPase OS=Saccharomonospora viridis (strain ATCC 15386 / DSM 43017 / JCM 3036 / NBRC 12207 / P101) GN=arc PE=3 SV=1 204 383 2.0E-06
sp|C7MCZ0|ARC_BRAFD AAA ATPase forming ring-shaped complexes OS=Brachybacterium faecium (strain ATCC 43885 / DSM 4810 / NCIB 9860) GN=arc PE=3 SV=1 204 364 2.0E-06
sp|D2Q4G5|ARC_KRIFD Proteasome-associated ATPase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) GN=arc PE=3 SV=1 208 409 2.0E-06
sp|P46471|PRS7_MOUSE 26S protease regulatory subunit 7 OS=Mus musculus GN=Psmc2 PE=1 SV=5 173 400 2.0E-06
sp|Q4R4R0|PRS7_MACFA 26S protease regulatory subunit 7 OS=Macaca fascicularis GN=PSMC2 PE=2 SV=3 173 400 2.0E-06
sp|P35998|PRS7_HUMAN 26S protease regulatory subunit 7 OS=Homo sapiens GN=PSMC2 PE=1 SV=3 173 400 2.0E-06
sp|Q5E9F9|PRS7_BOVIN 26S protease regulatory subunit 7 OS=Bos taurus GN=PSMC2 PE=2 SV=3 173 400 2.0E-06
sp|Q9C0W2|YHI5_SCHPO Uncharacterized AAA domain-containing protein P22H7.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi026 PE=3 SV=1 188 400 2.0E-06
sp|P46472|PRS7_XENLA 26S protease regulatory subunit 7 OS=Xenopus laevis GN=psmc2 PE=2 SV=1 173 400 3.0E-06
sp|D3Q568|ARC_STANL Proteasome-associated ATPase OS=Stackebrandtia nassauensis (strain DSM 44728 / NRRL B-16338 / NBRC 102104 / LLR-40K-21) GN=arc PE=3 SV=1 204 383 3.0E-06
sp|O74894|PRS6B_SCHPO 26S protease regulatory subunit 6B homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpt3 PE=3 SV=1 204 378 3.0E-06
sp|O88967|YMEL1_MOUSE ATP-dependent zinc metalloprotease YME1L1 OS=Mus musculus GN=Yme1l1 PE=1 SV=1 204 406 3.0E-06
sp|Q8NQD8|ARC_CORGL AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=arc PE=3 SV=1 204 363 4.0E-06
sp|A4QE83|ARC_CORGB AAA ATPase forming ring-shaped complexes OS=Corynebacterium glutamicum (strain R) GN=arc PE=3 SV=1 204 363 4.0E-06
sp|P33299|PRS7_YEAST 26S protease regulatory subunit 7 homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPT1 PE=1 SV=1 204 400 4.0E-06
sp|O50202|ARC_RHOER Proteasome-associated ATPase OS=Rhodococcus erythropolis GN=arc PE=1 SV=1 204 405 5.0E-06
sp|C0ZZV2|ARC_RHOE4 Proteasome-associated ATPase OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=arc PE=3 SV=1 204 405 5.0E-06
sp|P46502|PRS6B_CAEEL Probable 26S protease regulatory subunit 6B OS=Caenorhabditis elegans GN=rpt-3 PE=3 SV=1 208 380 5.0E-06
sp|A7YSY2|SPA5L_BOVIN Spermatogenesis-associated protein 5-like protein 1 OS=Bos taurus GN=SPATA5L1 PE=2 SV=1 188 400 8.0E-06
sp|C7R400|ARC_JONDD Proteasome-associated ATPase OS=Jonesia denitrificans (strain ATCC 14870 / DSM 20603 / CIP 55134) GN=arc PE=3 SV=1 204 394 9.0E-06
sp|Q6AZT2|SPAST_XENLA Spastin OS=Xenopus laevis GN=spast PE=2 SV=1 205 400 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009378 four-way junction helicase activity Yes
GO:0005524 ATP binding Yes
GO:0006281 DNA repair Yes
GO:0016887 ATPase activity Yes
GO:0006310 DNA recombination Yes
GO:0006807 nitrogen compound metabolic process No
GO:0033554 cellular response to stress No
GO:0044237 cellular metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0006950 response to stress No
GO:0006259 DNA metabolic process No
GO:0016462 pyrophosphatase activity No
GO:0071704 organic substance metabolic process No
GO:0003674 molecular_function No
GO:0046483 heterocycle metabolic process No
GO:0005488 binding No
GO:1901265 nucleoside phosphate binding No
GO:0050896 response to stimulus No
GO:0044238 primary metabolic process No
GO:0008152 metabolic process No
GO:0140097 catalytic activity, acting on DNA No
GO:0008144 drug binding No
GO:0008150 biological_process No
GO:0036094 small molecule binding No
GO:0044260 cellular macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0003678 DNA helicase activity No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0043168 anion binding No
GO:0004386 helicase activity No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0051716 cellular response to stimulus No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0016787 hydrolase activity No
GO:0017076 purine nucleotide binding No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006974 cellular response to DNA damage stimulus No
GO:0032553 ribonucleotide binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0030554 adenyl nucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6237
MPPGRSNPRLSFRSSLDRDVYQIVKRFEEAEQRPASFKSVSAAYEAIKRSNSSLARLKKRPLEDAIDRVLQIRKQ
EKKHDDESDDSEAAIDEPEPAAKAEDERFLLNRQMTKLWNVENGTPSSGEQPATKKRRINTDTEDKDEQTEGAEA
GEGTALTIDKRDKPRAKSHQKSTRYQVEHPGESLSSDGAEEVFVDLMSAAWTRLIDPDFYSTESKRPPSGFLLCG
PSGVGKKTVIKHLAATIGVPTVSLAGCFEDPERAERSLTEAFDTATSLAPCILYVEHIDQCMPRPSASSHNDPQH
RATRCFARQMARIRSVEGDTKPIFAIATTSNVLEIDPAVLKVGLFESAVQMKIPDSASRRDILGALTRRLSLAQD
VNLAEIAGMTHGYVASDLVQILTNAIEQSKVRMTKEQRPFDAMLRLYLQLGKRSSPEDEPDYERCRQYLRGATEM
SPLLGPVIMEDFKSAIKQFTPSLRKEGFTVIPDVTWDHVGGLDEARKQLKMSIIGPIKEPDVYRKFGLRRSAGVL
LWGPPGCGKTLVAQAVANEAQASLILINGPELLNKYVGESERAIRELFQRARSSTPCILFFDEIDSLVPPRGSTS
TDSAARVVDALLTELDGAQDRSGIYVIGTTNRPDLIDEAMLRPGRLSVQLLVNLPTPAERVDILRAIYRTCHDEA
ADDALEPLAAVALDRRCANFSGADLSGLHTKAAEGALQKWMEAGGEGPHVIAEADWEYALANTRASIKDPAFYQR
RSS*
Coding >Hirsu2|6237
ATGCCGCCTGGCAGATCGAACCCCCGCCTTAGCTTTCGCAGCAGCCTCGACCGAGACGTATACCAAATTGTTAAG
AGGTTCGAAGAAGCCGAGCAACGGCCAGCCTCCTTTAAATCCGTCTCCGCCGCATATGAGGCCATAAAACGGTCC
AATTCGAGCCTCGCCAGGCTGAAGAAGCGCCCCCTCGAGGATGCGATAGACCGGGTGCTGCAGATCCGCAAGCAA
GAGAAGAAGCACGACGATGAGTCGGACGACTCCGAAGCGGCCATCGACGAACCCGAGCCCGCCGCCAAAGCGGAA
GACGAGAGGTTCCTCCTCAACCGCCAAATGACGAAACTCTGGAACGTGGAAAATGGCACACCGAGTTCGGGCGAG
CAGCCAGCGACGAAGAAGCGCCGCATAAACACCGACACAGAAGACAAGGACGAACAGACCGAAGGCGCTGAAGCC
GGCGAAGGCACTGCCTTGACGATCGATAAGCGCGATAAGCCGCGCGCGAAAAGCCATCAAAAATCGACTCGCTAC
CAAGTCGAGCATCCGGGAGAGTCTCTCTCATCGGACGGCGCGGAGGAAGTCTTTGTCGACCTCATGAGCGCCGCC
TGGACACGCCTCATAGATCCGGACTTTTACTCGACAGAGTCTAAGCGACCACCTTCGGGCTTCCTCCTGTGCGGA
CCTTCGGGCGTGGGGAAGAAGACGGTCATCAAACACCTGGCCGCGACAATCGGCGTCCCCACAGTGTCCCTGGCA
GGCTGCTTCGAAGACCCAGAGCGGGCAGAACGAAGTCTCACCGAAGCCTTCGACACCGCCACCAGCCTGGCGCCT
TGCATACTGTATGTCGAGCACATCGATCAATGTATGCCGCGGCCCAGCGCCTCGAGCCACAATGACCCGCAACAT
CGTGCGACGAGGTGCTTCGCGAGACAGATGGCACGCATCCGCAGTGTTGAGGGGGATACCAAGCCGATCTTTGCC
ATTGCAACGACCTCGAACGTCCTCGAGATTGATCCAGCTGTCCTGAAGGTGGGTCTATTCGAGAGCGCCGTTCAA
ATGAAGATACCCGACAGCGCTTCGCGGCGGGATATCCTGGGCGCCCTTACCCGGCGGCTGTCTCTTGCCCAGGAC
GTGAATCTCGCTGAGATCGCCGGCATGACACATGGCTATGTCGCGTCGGATCTCGTCCAGATCCTCACCAACGCG
ATAGAGCAATCCAAGGTCCGGATGACCAAGGAACAAAGACCGTTCGACGCCATGCTTCGGCTGTACCTCCAACTA
GGGAAGAGGAGCAGCCCGGAGGACGAACCGGACTACGAACGCTGCAGACAGTATCTGAGAGGCGCGACGGAGATG
TCGCCCCTGCTGGGCCCGGTAATCATGGAGGACTTCAAGTCGGCCATCAAGCAATTCACGCCGTCGCTCAGGAAA
GAGGGCTTCACCGTCATACCCGACGTCACGTGGGACCACGTGGGCGGACTGGACGAGGCCCGCAAGCAGCTGAAG
ATGTCCATCATCGGTCCCATCAAGGAGCCGGATGTTTACCGAAAGTTCGGCCTCCGACGCTCGGCGGGCGTGCTG
CTCTGGGGCCCCCCCGGCTGCGGCAAGACCCTGGTGGCCCAGGCCGTCGCCAACGAAGCCCAGGCCAGTCTGATC
CTGATCAACGGCCCCGAGCTGCTGAACAAGTACGTGGGCGAGTCGGAGCGGGCCATCCGGGAGCTTTTCCAGCGA
GCGCGCTCCTCGACCCCGTGCATCCTCTTCTTCGACGAGATCGACTCGCTCGTGCCGCCGCGCGGCAGCACGTCG
ACCGACTCGGCCGCCAGGGTCGTCGACGCCCTGCTCACCGAGCTCGACGGCGCCCAGGACCGGTCAGGCATCTAC
GTCATCGGCACGACCAACCGGCCGGACCTGATCGACGAGGCCATGCTGCGGCCCGGCCGGCTCAGCGTCCAGCTG
CTCGTCAACCTGCCGACGCCGGCGGAGCGCGTCGACATCCTGCGCGCCATCTACCGGACCTGCCACGACGAGGCC
GCGGACGACGCGCTGGAGCCCCTGGCGGCGGTGGCCCTGGACCGCCGCTGCGCCAACTTCAGCGGCGCGGACCTG
AGCGGCCTGCACACCAAGGCCGCCGAGGGCGCGCTGCAGAAGTGGATGGAGGCCGGCGGCGAGGGCCCGCACGTC
ATCGCCGAGGCGGACTGGGAGTACGCGCTGGCCAACACGCGCGCCAGCATCAAGGACCCCGCCTTCTACCAGCGC
CGGTCCTCGTAG
Transcript >Hirsu2|6237
ATGCCGCCTGGCAGATCGAACCCCCGCCTTAGCTTTCGCAGCAGCCTCGACCGAGACGTATACCAAATTGTTAAG
AGGTTCGAAGAAGCCGAGCAACGGCCAGCCTCCTTTAAATCCGTCTCCGCCGCATATGAGGCCATAAAACGGTCC
AATTCGAGCCTCGCCAGGCTGAAGAAGCGCCCCCTCGAGGATGCGATAGACCGGGTGCTGCAGATCCGCAAGCAA
GAGAAGAAGCACGACGATGAGTCGGACGACTCCGAAGCGGCCATCGACGAACCCGAGCCCGCCGCCAAAGCGGAA
GACGAGAGGTTCCTCCTCAACCGCCAAATGACGAAACTCTGGAACGTGGAAAATGGCACACCGAGTTCGGGCGAG
CAGCCAGCGACGAAGAAGCGCCGCATAAACACCGACACAGAAGACAAGGACGAACAGACCGAAGGCGCTGAAGCC
GGCGAAGGCACTGCCTTGACGATCGATAAGCGCGATAAGCCGCGCGCGAAAAGCCATCAAAAATCGACTCGCTAC
CAAGTCGAGCATCCGGGAGAGTCTCTCTCATCGGACGGCGCGGAGGAAGTCTTTGTCGACCTCATGAGCGCCGCC
TGGACACGCCTCATAGATCCGGACTTTTACTCGACAGAGTCTAAGCGACCACCTTCGGGCTTCCTCCTGTGCGGA
CCTTCGGGCGTGGGGAAGAAGACGGTCATCAAACACCTGGCCGCGACAATCGGCGTCCCCACAGTGTCCCTGGCA
GGCTGCTTCGAAGACCCAGAGCGGGCAGAACGAAGTCTCACCGAAGCCTTCGACACCGCCACCAGCCTGGCGCCT
TGCATACTGTATGTCGAGCACATCGATCAATGTATGCCGCGGCCCAGCGCCTCGAGCCACAATGACCCGCAACAT
CGTGCGACGAGGTGCTTCGCGAGACAGATGGCACGCATCCGCAGTGTTGAGGGGGATACCAAGCCGATCTTTGCC
ATTGCAACGACCTCGAACGTCCTCGAGATTGATCCAGCTGTCCTGAAGGTGGGTCTATTCGAGAGCGCCGTTCAA
ATGAAGATACCCGACAGCGCTTCGCGGCGGGATATCCTGGGCGCCCTTACCCGGCGGCTGTCTCTTGCCCAGGAC
GTGAATCTCGCTGAGATCGCCGGCATGACACATGGCTATGTCGCGTCGGATCTCGTCCAGATCCTCACCAACGCG
ATAGAGCAATCCAAGGTCCGGATGACCAAGGAACAAAGACCGTTCGACGCCATGCTTCGGCTGTACCTCCAACTA
GGGAAGAGGAGCAGCCCGGAGGACGAACCGGACTACGAACGCTGCAGACAGTATCTGAGAGGCGCGACGGAGATG
TCGCCCCTGCTGGGCCCGGTAATCATGGAGGACTTCAAGTCGGCCATCAAGCAATTCACGCCGTCGCTCAGGAAA
GAGGGCTTCACCGTCATACCCGACGTCACGTGGGACCACGTGGGCGGACTGGACGAGGCCCGCAAGCAGCTGAAG
ATGTCCATCATCGGTCCCATCAAGGAGCCGGATGTTTACCGAAAGTTCGGCCTCCGACGCTCGGCGGGCGTGCTG
CTCTGGGGCCCCCCCGGCTGCGGCAAGACCCTGGTGGCCCAGGCCGTCGCCAACGAAGCCCAGGCCAGTCTGATC
CTGATCAACGGCCCCGAGCTGCTGAACAAGTACGTGGGCGAGTCGGAGCGGGCCATCCGGGAGCTTTTCCAGCGA
GCGCGCTCCTCGACCCCGTGCATCCTCTTCTTCGACGAGATCGACTCGCTCGTGCCGCCGCGCGGCAGCACGTCG
ACCGACTCGGCCGCCAGGGTCGTCGACGCCCTGCTCACCGAGCTCGACGGCGCCCAGGACCGGTCAGGCATCTAC
GTCATCGGCACGACCAACCGGCCGGACCTGATCGACGAGGCCATGCTGCGGCCCGGCCGGCTCAGCGTCCAGCTG
CTCGTCAACCTGCCGACGCCGGCGGAGCGCGTCGACATCCTGCGCGCCATCTACCGGACCTGCCACGACGAGGCC
GCGGACGACGCGCTGGAGCCCCTGGCGGCGGTGGCCCTGGACCGCCGCTGCGCCAACTTCAGCGGCGCGGACCTG
AGCGGCCTGCACACCAAGGCCGCCGAGGGCGCGCTGCAGAAGTGGATGGAGGCCGGCGGCGAGGGCCCGCACGTC
ATCGCCGAGGCGGACTGGGAGTACGCGCTGGCCAACACGCGCGCCAGCATCAAGGACCCCGCCTTCTACCAGCGC
CGGTCCTCGTAG
Gene >Hirsu2|6237
ATGCCGCCTGGCAGATCGAACCCCCGCCTTAGCTTTCGCAGCAGCCTCGACCGAGACGTATACCAAATTGTTAAG
AGGTTCGAAGAAGCCGAGCAACGGCCAGCCTCCTTTAAATCCGTCTCCGCCGCATATGAGGCCATAAAACGGTCC
AATTCGAGCCTCGCCAGGCTGAAGAAGCGCCCCCTCGAGGATGCGATAGACCGGGTGCTGCAGATCCGCAAGCAA
GAGAAGAAGCACGACGATGAGTCGGACGACTCCGAAGCGGCCATCGACGAACCCGAGCCCGCCGCCAAAGCGGAA
GACGAGAGGTTCCTCCTCAACCGCCAAATGACGAAACTCTGGAACGTGGAAAATGGCACACCGAGTTCGGGCGAG
CAGCCAGCGACGAAGAAGCGCCGCATAAACACCGACACAGAAGACAAGGACGAACAGACCGAAGGCGCTGAAGCC
GGCGAAGGCACTGCCTTGACGATCGATAAGCGCGATAAGCCGCGCGCGAAAAGCCATCAAAAATCGACTCGCTAC
CAAGTCGAGCATCCGGGAGAGTCTCTCTCATCGGACGGCGCGGAGGAAGTCTTTGTCGACCTCATGAGCGCCGCC
TGGACACGCCTCATAGATCCGGACTTTTACTCGACAGAGTCTAAGCGACCACCTTCGGGCTTCCTCCTGTGCGGA
CCTTCGGGCGTGGGGAAGAAGACGGTCATCAAACACCTGGCCGCGACAATCGGCGTCCCCACAGTGTCCCTGGCA
GGCTGCTTCGAAGACCCAGAGCGGGCAGAACGAAGTCTCACCGAAGCCTTCGACACCGCCACCAGCCTGGCGCCT
TGCATACTGTATGTCGAGCACATCGATCAATGTATGCCGCGGCCCAGCGCCTCGAGCCACAATGACCCGCAACAT
CGTGCGACGAGGTGCTTCGCGAGACAGATGGCACGCATCCGCAGTGTTGAGGGGGATACCAAGCCGATCTTTGCC
ATTGCAACGACCTCGAACGTCCTCGAGATTGATCCAGCTGTCCTGAAGGTGGGTCTATTCGAGAGCGCCGTTCAA
ATGAAGATACCCGACAGCGCTTCGCGGCGGGATATCCTGGGCGCCCTTACCCGGCGGCTGTCTCTTGCCCAGGAC
GTGAATCTCGCTGAGATCGCCGGCATGACACATGGCTATGTCGCGTCGGATCTCGTCCAGATCCTCACCAACGCG
ATAGAGCAATCCAAGGTCCGGATGACCAAGGAACAAAGACCGTTCGACGCCATGCTTCGGCTGTACCTCCAACTA
GGGAAGAGGAGCAGCCCGGAGGACGAACCGGACTACGAACGCTGCAGACAGTATCTGAGAGGCGCGACGGAGATG
TCGCCCCTGCTGGGCCCGGTAATCATGGAGGACTTCAAGTCGGCCATCAAGCAATTCACGCCGTCGCTCAGGAAA
GAGGGCTTCACCGTCATACCCGACGTCACGTGGGACCACGTGGGCGGACTGGACGAGGCCCGCAAGCAGCTGAAG
ATGTCCATCATCGGTCCCATCAAGGAGCCGGATGTTTACCGAAAGTTCGGCCTCCGACGCTCGGCGGGCGTGCTG
CTCTGGGGCCCCCCCGGCTGCGGCAAGACCCTGGTGGCCCAGGCCGTCGCCAACGAAGCCCAGGCCAGTCTGATC
CTGATCAACGGCCCCGAGCTGCTGAACAAGTACGTGGGCGAGTCGGAGCGGGCCATCCGGGAGCTTTTCCAGCGA
GCGCGCTCCTCGACCCCGTGCATCCTCTTCTTCGACGAGATCGACTCGCTCGTGCCGCCGCGCGGCAGCACGTCG
ACCGACTCGGCCGCCAGGGTCGTCGACGCCCTGCTCACCGAGCTCGACGGCGCCCAGGACCGGTCAGGCATCTAC
GTCATCGGCACGACCAACCGGCCGGACCTGATCGACGAGGCCATGCTGCGGCCCGGCCGGCTCAGCGTCCAGCTG
CTCGTCAACCTGCCGACGCCGGCGGAGCGCGTCGACATCCTGCGCGCCATCTACCGGACCTGCCACGACGAGGCC
GCGGACGACGCGCTGGAGCCCCTGGCGGCGGTGGCCCTGGACCGCCGCTGCGCCAACTTCAGCGGCGCGGACCTG
AGCGGCCTGCACACCAAGGCCGCCGAGGGCGCGCTGCAGAAGTGGATGGAGGCCGGCGGCGAGGGCCCGCACGTC
ATCGCCGAGGCGGACTGGGAGTACGCGCTGGCCAACACGCGCGCCAGCATCAAGGACCCCGCCTTCTACCAGCGC
CGGTCCTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail