Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6235
Gene name
LocationContig_318:76..637
Strand+
Gene length (bp)561
Transcript length (bp)471
Coding sequence length (bp)471
Protein length (aa) 157

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03881 Fructosamin_kin Fructosamine kinase 5.3E-37 8 152

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K274|KT3K_MOUSE Ketosamine-3-kinase OS=Mus musculus GN=Fn3krp PE=1 SV=2 30 150 7.0E-25
sp|Q9HA64|KT3K_HUMAN Ketosamine-3-kinase OS=Homo sapiens GN=FN3KRP PE=1 SV=2 30 151 8.0E-25
sp|Q9ER35|FN3K_MOUSE Fructosamine-3-kinase OS=Mus musculus GN=Fn3k PE=1 SV=1 43 151 7.0E-24
sp|Q9H479|FN3K_HUMAN Fructosamine-3-kinase OS=Homo sapiens GN=FN3K PE=1 SV=1 43 151 2.0E-23
sp|Q10SM2|FN3KR_ORYSJ Protein-ribulosamine 3-kinase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0117800 PE=2 SV=1 39 147 8.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8K274|KT3K_MOUSE Ketosamine-3-kinase OS=Mus musculus GN=Fn3krp PE=1 SV=2 30 150 7.0E-25
sp|Q9HA64|KT3K_HUMAN Ketosamine-3-kinase OS=Homo sapiens GN=FN3KRP PE=1 SV=2 30 151 8.0E-25
sp|Q9ER35|FN3K_MOUSE Fructosamine-3-kinase OS=Mus musculus GN=Fn3k PE=1 SV=1 43 151 7.0E-24
sp|Q9H479|FN3K_HUMAN Fructosamine-3-kinase OS=Homo sapiens GN=FN3K PE=1 SV=1 43 151 2.0E-23
sp|Q10SM2|FN3KR_ORYSJ Protein-ribulosamine 3-kinase, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0117800 PE=2 SV=1 39 147 8.0E-19
sp|A2XBT1|FN3KR_ORYSI Protein-ribulosamine 3-kinase, chloroplastic OS=Oryza sativa subsp. indica GN=OsI_09747 PE=3 SV=1 39 147 9.0E-19
sp|Q9LEW8|FN3KR_ARATH Protein-ribulosamine 3-kinase, chloroplastic OS=Arabidopsis thaliana GN=At3g61080 PE=1 SV=2 43 147 1.0E-18
sp|P74594|Y1563_SYNY3 Uncharacterized protein slr1563 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1563 PE=3 SV=1 24 151 2.0E-17
sp|Q87PM1|Y1481_VIBPA Uncharacterized protein VP1481 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=VP1481 PE=3 SV=1 29 152 2.0E-15
sp|Q9KRU5|Y1539_VIBCH Uncharacterized protein VC_1539 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_1539 PE=3 SV=1 45 152 9.0E-14
sp|Q8D9N5|Y2562_VIBVU Uncharacterized protein VV1_2562 OS=Vibrio vulnificus (strain CMCP6) GN=VV1_2562 PE=3 SV=1 45 152 4.0E-13
sp|P77739|YNIA_ECOLI Uncharacterized protein YniA OS=Escherichia coli (strain K12) GN=yniA PE=3 SV=1 22 152 1.0E-08
sp|P58065|YNIA_ECO57 Uncharacterized protein YniA OS=Escherichia coli O157:H7 GN=yniA PE=3 SV=1 22 152 2.0E-08
sp|P46382|YNIA_KLEPN Uncharacterized protein in tonB 3'region (Fragment) OS=Klebsiella pneumoniae PE=3 SV=1 45 139 2.0E-08
sp|P46381|YNIA_ENTAK Uncharacterized protein EAE_16955 OS=Enterobacter aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006) GN=EAE_16955 PE=3 SV=2 45 149 2.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5872 0.6084 0.4539 0.03 0.375 0.0653 0.2384 0.1424 0.0731 0.0111

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup635
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1624
Ophiocordyceps australis map64 (Brazil) OphauB2|6753
Ophiocordyceps camponoti-floridani Ophcf2|06717
Ophiocordyceps camponoti-rufipedis Ophun1|459
Ophiocordyceps kimflemingae Ophio5|3676
Ophiocordyceps subramaniannii Hirsu2|1032
Ophiocordyceps subramaniannii Hirsu2|6235 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6235
LRAVLGACVARNGPDAGLAAAVDAVAGRVVPRLLGDGRLEPAVVPVVVHGDLWSGNHAIGRIAGAGAVEHLVFDP
SAVYGHAEYELGIMTMFGGFGPDFWREYHELVPKAEPVAEWDDRIMLYELYHHLNHFAIFGGSYRGGAMSIMKKL
IAKYGG*
Coding >Hirsu2|6235
CTGCGGGCCGTGCTGGGCGCCTGCGTTGCCCGCAACGGGCCCGATGCCGGCCTGGCGGCGGCCGTCGACGCCGTC
GCGGGGCGGGTCGTGCCGCGCCTGCTGGGTGACGGCCGCCTCGAGCCCGCTGTCGTCCCCGTCGTCGTCCACGGC
GACCTCTGGAGCGGCAACCACGCGATCGGCCGGATCGCCGGCGCCGGCGCCGTCGAGCACCTCGTCTTCGACCCT
TCCGCCGTCTACGGCCACGCCGAGTACGAGCTCGGCATCATGACCATGTTTGGCGGCTTCGGCCCCGACTTCTGG
CGCGAGTACCACGAGCTCGTGCCCAAGGCGGAGCCCGTGGCCGAGTGGGACGACCGCATCATGCTGTACGAGCTG
TACCATCATTTGAACCACTTTGCCATCTTTGGCGGCAGCTATCGCGGCGGGGCCATGTCCATCATGAAAAAGCTC
ATCGCCAAGTATGGCGGCTGA
Transcript >Hirsu2|6235
CTGCGGGCCGTGCTGGGCGCCTGCGTTGCCCGCAACGGGCCCGATGCCGGCCTGGCGGCGGCCGTCGACGCCGTC
GCGGGGCGGGTCGTGCCGCGCCTGCTGGGTGACGGCCGCCTCGAGCCCGCTGTCGTCCCCGTCGTCGTCCACGGC
GACCTCTGGAGCGGCAACCACGCGATCGGCCGGATCGCCGGCGCCGGCGCCGTCGAGCACCTCGTCTTCGACCCT
TCCGCCGTCTACGGCCACGCCGAGTACGAGCTCGGCATCATGACCATGTTTGGCGGCTTCGGCCCCGACTTCTGG
CGCGAGTACCACGAGCTCGTGCCCAAGGCGGAGCCCGTGGCCGAGTGGGACGACCGCATCATGCTGTACGAGCTG
TACCATCATTTGAACCACTTTGCCATCTTTGGCGGCAGCTATCGCGGCGGGGCCATGTCCATCATGAAAAAGCTC
ATCGCCAAGTATGGCGGCTGA
Gene >Hirsu2|6235
CTGCGGGCCGTGCTGGGCGCCTGCGTTGCCCGCAACGGGCCCGATGCCGGCCTGGCGGCGGCCGTCGACGCCGTC
GCGGGGCGGGTCGTGCCGCGCCTGCTGGGTGACGGCCGCCTCGAGCCCGCTGTCGTCCCCGTCGTCGTCCACGGC
GACCTCTGGAGCGGCAACCACGCGATCGGCCGGATCGCCGGCGCCGGCGCCGTCGAGCACCTCGTCTTCGACCCT
TCCGCCGTCTACGGCCACGCCGAGTACGAGCTCGGCATCATGACCATGTTTGGCGGCTTCGGCCCCGACTTCTGG
CGCGAGTACCACGAGCTCGTGCCCAAGGCGGAGCCCGTGGCCGAGTGGGACGACCGCATCATGCTGTACGAGCTG
TGAGTCACTCACTTGTTTGTTTTCCTCCTTGTCCCACCCGCTTGCTCCATCTCTGTCGTCGACCAACACGTTGCT
CACTGGGATTGCAGGTACCATCATTTGAACCACTTTGCCATCTTTGGCGGCAGCTATCGCGGCGGGGCCATGTCC
ATCATGAAAAAGCTCATCGCCAAGTATGGCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail