Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6234
Gene name
LocationContig_3179:729..1206
Strand-
Gene length (bp)477
Transcript length (bp)477
Coding sequence length (bp)477
Protein length (aa) 159

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11969 DcpS_C Scavenger mRNA decapping enzyme C-term binding 4.4E-23 2 90

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C9|DCPS_SCHPO m7GpppX diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhm1 PE=1 SV=1 1 146 4.0E-31
sp|Q12123|DCS2_YEAST Inactive diphosphatase DCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS2 PE=1 SV=3 1 139 6.0E-24
sp|Q06151|DCPS_YEAST m7GpppX diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS1 PE=1 SV=1 1 134 1.0E-23
sp|D3K0N9|DCPS_ASCSU m7GpppX diphosphatase OS=Ascaris suum PE=1 SV=1 1 108 2.0E-19
sp|G5EFS4|DCPS_CAEEL m7GpppX diphosphatase OS=Caenorhabditis elegans GN=dcs-1 PE=1 SV=1 1 108 1.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7C9|DCPS_SCHPO m7GpppX diphosphatase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nhm1 PE=1 SV=1 1 146 4.0E-31
sp|Q12123|DCS2_YEAST Inactive diphosphatase DCS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS2 PE=1 SV=3 1 139 6.0E-24
sp|Q06151|DCPS_YEAST m7GpppX diphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCS1 PE=1 SV=1 1 134 1.0E-23
sp|D3K0N9|DCPS_ASCSU m7GpppX diphosphatase OS=Ascaris suum PE=1 SV=1 1 108 2.0E-19
sp|G5EFS4|DCPS_CAEEL m7GpppX diphosphatase OS=Caenorhabditis elegans GN=dcs-1 PE=1 SV=1 1 108 1.0E-17
sp|Q8K4F7|DCPS_RAT m7GpppX diphosphatase OS=Rattus norvegicus GN=Dcps PE=2 SV=1 1 109 5.0E-17
sp|Q9DAR7|DCPS_MOUSE m7GpppX diphosphatase OS=Mus musculus GN=Dcps PE=1 SV=1 1 109 6.0E-17
sp|Q8MIZ3|DCPS_PIG m7GpppX diphosphatase OS=Sus scrofa GN=DCPS PE=2 SV=1 1 107 2.0E-16
sp|Q8MJJ7|DCPS_BOVIN m7GpppX diphosphatase OS=Bos taurus GN=DCPS PE=2 SV=1 1 107 2.0E-16
sp|Q96C86|DCPS_HUMAN m7GpppX diphosphatase OS=Homo sapiens GN=DCPS PE=1 SV=2 1 109 5.0E-16
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5684 0.4904 0.0841 0.0668 0.2783 0.0928 0.2717 0.2528 0.2409 0.3141

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5460
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5414
Ophiocordyceps australis map64 (Brazil) OphauB2|3875
Ophiocordyceps camponoti-floridani Ophcf2|04130
Ophiocordyceps camponoti-rufipedis Ophun1|912
Ophiocordyceps kimflemingae Ophio5|7030
Ophiocordyceps subramaniannii Hirsu2|6234 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6234
LLLPDLNWDRATVEALHLLALVRRRDLWSLRDLRKRHVGWLRRMREALVAATVAAFPSVAADQLKLYLHYQPTYY
HLHVHIVHVALEAGATQAVGKAVALDAIVETLRAMAGGDDAGMDALDLSYTLGEASDLWNDVFAPLTTTTAAPAS
SRSPPPGR*
Coding >Hirsu2|6234
CTGCTGCTGCCGGACCTCAACTGGGACCGGGCCACGGTCGAGGCGCTGCACCTGCTGGCGCTGGTGCGGCGGCGC
GACCTGTGGTCGCTGCGCGACCTGCGCAAGCGCCACGTCGGCTGGCTGCGGCGCATGCGCGAGGCCCTCGTCGCC
GCCACCGTGGCCGCGTTCCCGTCCGTGGCGGCCGACCAGCTCAAGCTGTACCTCCACTACCAGCCCACCTACTAC
CACCTGCACGTCCACATCGTCCACGTCGCGCTCGAGGCCGGCGCCACCCAGGCCGTCGGCAAGGCCGTCGCGCTC
GACGCCATCGTCGAGACGCTGCGCGCCATGGCCGGCGGCGACGACGCCGGCATGGACGCCCTCGACCTGTCCTAC
ACGCTCGGCGAGGCCAGCGACCTGTGGAACGACGTCTTCGCCCCGCTCACGACGACGACCGCTGCACCAGCTTCT
TCTCGATCGCCACCACCAGGTCGTTGA
Transcript >Hirsu2|6234
CTGCTGCTGCCGGACCTCAACTGGGACCGGGCCACGGTCGAGGCGCTGCACCTGCTGGCGCTGGTGCGGCGGCGC
GACCTGTGGTCGCTGCGCGACCTGCGCAAGCGCCACGTCGGCTGGCTGCGGCGCATGCGCGAGGCCCTCGTCGCC
GCCACCGTGGCCGCGTTCCCGTCCGTGGCGGCCGACCAGCTCAAGCTGTACCTCCACTACCAGCCCACCTACTAC
CACCTGCACGTCCACATCGTCCACGTCGCGCTCGAGGCCGGCGCCACCCAGGCCGTCGGCAAGGCCGTCGCGCTC
GACGCCATCGTCGAGACGCTGCGCGCCATGGCCGGCGGCGACGACGCCGGCATGGACGCCCTCGACCTGTCCTAC
ACGCTCGGCGAGGCCAGCGACCTGTGGAACGACGTCTTCGCCCCGCTCACGACGACGACCGCTGCACCAGCTTCT
TCTCGATCGCCACCACCAGGTCGTTGA
Gene >Hirsu2|6234
CTGCTGCTGCCGGACCTCAACTGGGACCGGGCCACGGTCGAGGCGCTGCACCTGCTGGCGCTGGTGCGGCGGCGC
GACCTGTGGTCGCTGCGCGACCTGCGCAAGCGCCACGTCGGCTGGCTGCGGCGCATGCGCGAGGCCCTCGTCGCC
GCCACCGTGGCCGCGTTCCCGTCCGTGGCGGCCGACCAGCTCAAGCTGTACCTCCACTACCAGCCCACCTACTAC
CACCTGCACGTCCACATCGTCCACGTCGCGCTCGAGGCCGGCGCCACCCAGGCCGTCGGCAAGGCCGTCGCGCTC
GACGCCATCGTCGAGACGCTGCGCGCCATGGCCGGCGGCGACGACGCCGGCATGGACGCCCTCGACCTGTCCTAC
ACGCTCGGCGAGGCCAGCGACCTGTGGAACGACGTCTTCGCCCCGCTCACGACGACGACCGCTGCACCAGCTTCT
TCTCGATCGCCACCACCAGGTCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail