Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|623
Gene name
LocationContig_1124:495..2310
Strand-
Gene length (bp)1815
Transcript length (bp)1650
Coding sequence length (bp)1650
Protein length (aa) 550

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02133 Transp_cyt_pur Permease for cytosine/purines, uracil, thiamine, allantoin 2.3E-149 36 488

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10279|FUR4_SCHPO Uracil permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fur4 PE=1 SV=2 12 538 0.0E+00
sp|O14035|YEME_SCHPO Uncharacterized permease C29B12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29B12.14c PE=3 SV=2 14 549 0.0E+00
sp|P05316|FUR4_YEAST Uracil permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR4 PE=3 SV=2 21 549 6.0E-154
sp|Q04895|DAL4_YEAST Allantoin permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL4 PE=1 SV=1 17 546 6.0E-152
sp|P38196|FUI1_YEAST Uridine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUI1 PE=1 SV=1 13 505 1.0E-146
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10279|FUR4_SCHPO Uracil permease OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fur4 PE=1 SV=2 12 538 0.0E+00
sp|O14035|YEME_SCHPO Uncharacterized permease C29B12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC29B12.14c PE=3 SV=2 14 549 0.0E+00
sp|P05316|FUR4_YEAST Uracil permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUR4 PE=3 SV=2 21 549 6.0E-154
sp|Q04895|DAL4_YEAST Allantoin permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL4 PE=1 SV=1 17 546 6.0E-152
sp|P38196|FUI1_YEAST Uridine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUI1 PE=1 SV=1 13 505 1.0E-146
sp|P94575|ALLP_BACSU Probable allantoin permease OS=Bacillus subtilis (strain 168) GN=pucI PE=2 SV=1 29 508 2.0E-71
sp|Q9P6J5|YHD5_SCHPO Uncharacterized permease C1683.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.05 PE=3 SV=1 3 508 2.0E-64
sp|Q9LZD0|NCS1_ARATH Purine-uracil permease NCS1 OS=Arabidopsis thaliana GN=NCS1 PE=1 SV=1 29 497 7.0E-63
sp|Q08485|NRT1_YEAST Nicotinamide riboside transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRT1 PE=1 SV=1 29 549 1.0E-54
sp|Q08579|THI72_YEAST Thiamine transporter THI72 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI72 PE=2 SV=1 29 549 7.0E-53
sp|Q05998|THI7_YEAST Thiamine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI7 PE=1 SV=1 29 549 1.0E-52
sp|P75712|ALLP_ECOLI Putative allantoin permease OS=Escherichia coli (strain K12) GN=ybbW PE=1 SV=2 31 511 5.0E-35
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

Domain # Start End Length
1 44 66 22
2 76 98 22
3 134 156 22
4 171 193 22
5 200 222 22
6 277 299 22
7 331 353 22
8 368 390 22
9 399 421 22
10 448 470 22
11 477 499 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|623
MAVRSRLSYWADRLAVESEPGLTSTQLMLTNHDLKPVEPERRQWGSWNFVGFWIADSFNINTWMISSSMVVGGLS
WWQAWLCVWIGYSIAAGFIVATGRIGAVYHIGFPVVSRASFGIWGSLWPVFNRALMACVWYGVQSYIGGHCVYLM
IRSVWTSWDRGRMPGPFNTDATSTPDFVSFFLFWLCSLPAIWFPVHKIRHLFTVKAYFVPPAAVALLVWAVVRAG
GAGPVVRQGNAVHGSELAWELVKGVMSSIANFSTLIINDCDFSRFARRPRDALWSQLLAIPLSFGLTSFIGIFVS
SASSLMYGEPVWDPLRLLERFIDDGGPAQRFGVFVIALAFALAQLGTNIAANSVSAGSDMAALLPRYIDIRRGGY
VCAAVGLAMCPYNLLTDANRFTTYLSAYSVFLSSIAGVMVADYYLVRRGFLDVAELYDGHRAGPYFYTAGVHWRA
YAAYVAGILINVVGFAGAVGADVPRGAVYLFNLNFFCGFAVSSATYWGLCRLSPIPATSERWMEVGGGGDDDERA
GFDRDSDQYDEEQMASAKSERFKT*
Coding >Hirsu2|623
ATGGCTGTCCGGTCACGCCTCAGCTACTGGGCCGACAGGCTGGCTGTCGAGTCTGAGCCCGGCCTGACGTCGACC
CAGCTCATGCTCACGAACCATGACCTCAAGCCCGTCGAGCCCGAGCGGCGCCAGTGGGGGAGCTGGAACTTTGTC
GGCTTCTGGATTGCCGACTCGTTCAACATCAACACGTGGATGATCTCGTCGTCCATGGTCGTCGGCGGCCTGTCG
TGGTGGCAGGCCTGGCTCTGCGTCTGGATCGGCTACTCCATTGCCGCCGGCTTCATCGTCGCCACGGGGCGCATC
GGCGCCGTCTACCACATCGGCTTCCCCGTCGTCAGCCGCGCCTCGTTCGGCATCTGGGGCAGCCTGTGGCCCGTC
TTCAACCGAGCTCTCATGGCCTGTGTCTGGTACGGCGTGCAGAGCTACATCGGAGGGCACTGCGTCTATCTCATG
ATTCGCTCGGTGTGGACGTCGTGGGACCGCGGCCGGATGCCGGGCCCCTTCAACACGGACGCGACCAGCACGCCC
GACTTCGTCTCCTTCTTCCTCTTTTGGCTCTGCTCCCTGCCGGCCATCTGGTTCCCCGTCCACAAGATCCGGCAC
CTGTTCACCGTCAAGGCCTACTTTGTGCCGCCGGCGGCGGTCGCGCTCCTGGTCTGGGCCGTCGTCCGGGCCGGC
GGCGCGGGCCCCGTCGTGCGGCAAGGCAACGCGGTCCACGGCAGCGAGCTGGCGTGGGAGCTTGTCAAGGGCGTC
ATGTCGTCCATCGCCAACTTCTCGACGCTCATCATCAACGACTGCGACTTCTCGCGGTTCGCGCGGCGGCCGCGG
GACGCGCTGTGGTCCCAGCTGCTGGCCATCCCGCTCAGCTTCGGCCTGACGTCCTTCATCGGCATCTTCGTCTCG
TCGGCGTCGAGCCTGATGTACGGCGAGCCCGTGTGGGACCCACTGAGGCTGCTGGAGCGGTTCATCGACGACGGC
GGCCCGGCGCAGCGGTTCGGCGTCTTCGTCATCGCCCTGGCCTTCGCCCTGGCCCAGCTCGGCACCAACATCGCG
GCCAACTCGGTCTCGGCCGGGTCCGACATGGCGGCGCTGCTGCCACGCTACATCGACATCCGGCGCGGCGGCTAC
GTCTGCGCCGCCGTCGGCCTGGCCATGTGCCCGTACAACCTGCTGACCGACGCGAACCGGTTCACGACGTACCTG
TCGGCCTACAGCGTCTTCCTCAGCTCCATCGCCGGCGTCATGGTCGCCGACTACTACCTCGTCCGCCGGGGCTTC
CTCGACGTGGCCGAGCTGTACGACGGCCACCGCGCGGGGCCGTACTTTTACACGGCGGGCGTCCACTGGCGCGCC
TACGCCGCCTACGTCGCCGGCATCCTGATCAACGTCGTCGGCTTCGCCGGCGCCGTCGGCGCCGACGTGCCCCGG
GGGGCCGTCTACCTCTTCAACCTCAACTTCTTTTGCGGCTTCGCCGTCTCGTCGGCCACGTACTGGGGCCTGTGC
CGACTGAGTCCCATCCCCGCCACGAGCGAGCGCTGGATGGAGGTGGGAGGGGGCGGGGACGACGACGAGCGCGCG
GGCTTCGACCGCGACAGCGACCAATACGACGAGGAGCAGATGGCCAGCGCCAAGAGCGAGCGGTTCAAGACGTGA
Transcript >Hirsu2|623
ATGGCTGTCCGGTCACGCCTCAGCTACTGGGCCGACAGGCTGGCTGTCGAGTCTGAGCCCGGCCTGACGTCGACC
CAGCTCATGCTCACGAACCATGACCTCAAGCCCGTCGAGCCCGAGCGGCGCCAGTGGGGGAGCTGGAACTTTGTC
GGCTTCTGGATTGCCGACTCGTTCAACATCAACACGTGGATGATCTCGTCGTCCATGGTCGTCGGCGGCCTGTCG
TGGTGGCAGGCCTGGCTCTGCGTCTGGATCGGCTACTCCATTGCCGCCGGCTTCATCGTCGCCACGGGGCGCATC
GGCGCCGTCTACCACATCGGCTTCCCCGTCGTCAGCCGCGCCTCGTTCGGCATCTGGGGCAGCCTGTGGCCCGTC
TTCAACCGAGCTCTCATGGCCTGTGTCTGGTACGGCGTGCAGAGCTACATCGGAGGGCACTGCGTCTATCTCATG
ATTCGCTCGGTGTGGACGTCGTGGGACCGCGGCCGGATGCCGGGCCCCTTCAACACGGACGCGACCAGCACGCCC
GACTTCGTCTCCTTCTTCCTCTTTTGGCTCTGCTCCCTGCCGGCCATCTGGTTCCCCGTCCACAAGATCCGGCAC
CTGTTCACCGTCAAGGCCTACTTTGTGCCGCCGGCGGCGGTCGCGCTCCTGGTCTGGGCCGTCGTCCGGGCCGGC
GGCGCGGGCCCCGTCGTGCGGCAAGGCAACGCGGTCCACGGCAGCGAGCTGGCGTGGGAGCTTGTCAAGGGCGTC
ATGTCGTCCATCGCCAACTTCTCGACGCTCATCATCAACGACTGCGACTTCTCGCGGTTCGCGCGGCGGCCGCGG
GACGCGCTGTGGTCCCAGCTGCTGGCCATCCCGCTCAGCTTCGGCCTGACGTCCTTCATCGGCATCTTCGTCTCG
TCGGCGTCGAGCCTGATGTACGGCGAGCCCGTGTGGGACCCACTGAGGCTGCTGGAGCGGTTCATCGACGACGGC
GGCCCGGCGCAGCGGTTCGGCGTCTTCGTCATCGCCCTGGCCTTCGCCCTGGCCCAGCTCGGCACCAACATCGCG
GCCAACTCGGTCTCGGCCGGGTCCGACATGGCGGCGCTGCTGCCACGCTACATCGACATCCGGCGCGGCGGCTAC
GTCTGCGCCGCCGTCGGCCTGGCCATGTGCCCGTACAACCTGCTGACCGACGCGAACCGGTTCACGACGTACCTG
TCGGCCTACAGCGTCTTCCTCAGCTCCATCGCCGGCGTCATGGTCGCCGACTACTACCTCGTCCGCCGGGGCTTC
CTCGACGTGGCCGAGCTGTACGACGGCCACCGCGCGGGGCCGTACTTTTACACGGCGGGCGTCCACTGGCGCGCC
TACGCCGCCTACGTCGCCGGCATCCTGATCAACGTCGTCGGCTTCGCCGGCGCCGTCGGCGCCGACGTGCCCCGG
GGGGCCGTCTACCTCTTCAACCTCAACTTCTTTTGCGGCTTCGCCGTCTCGTCGGCCACGTACTGGGGCCTGTGC
CGACTGAGTCCCATCCCCGCCACGAGCGAGCGCTGGATGGAGGTGGGAGGGGGCGGGGACGACGACGAGCGCGCG
GGCTTCGACCGCGACAGCGACCAATACGACGAGGAGCAGATGGCCAGCGCCAAGAGCGAGCGGTTCAAGACGTGA
Gene >Hirsu2|623
ATGGCTGTCCGGTCACGCCTCAGCTACTGGGCCGACAGGCTGGCTGTCGAGTCTGAGCCCGGCCTGACGTCGACC
CAGCTCATGGTGCGTCGTGGATGGCGAAGGCATCGCGCCACGGCCCCGAGGACAGCGCGCTAACACGGCGCCGGC
CGTCGAGCAGCTCACGAACCATGACCTCAAGCCCGTCGAGCCCGAGCGGCGCCAGTGGGGGAGCTGGAACTTTGT
CGGCTTCTGGATTGCCGACTCGTTCAACATCAACACGTGGATGATCTCGTCGTCCATGGTCGTCGGCGGCCTGTC
GTGGTGGCAGGCCTGGCTCTGCGTCTGGATCGGCTACTCCATTGCCGCCGGCTTCATCGTCGCCACGGGGCGCAT
CGGCGCCGTCTACCACATCGGCTTCCCCGTCGTCAGCCGCGCCTCGTTCGGCATCTGGGGCAGCCTGTGGCCCGT
CTTCAACCGAGCTCTCATGGGTACGCGTTCCGGGCGAAGCCCCATCTCCCTCTGCCCCGTCGGAACCAGCTGACC
GGGACACGTCATGACGGCGGCATTTTGAGCGAAGCCTGTGTCTGGTACGGCGTGCAGAGCTACATCGGAGGGCAC
TGCGTCTATCTCATGATTCGCTCGGTGTGGACGTCGTGGGACCGCGGCCGGATGCCGGGCCCCTTCAACACGGAC
GCGACCAGCACGCCCGACTTCGTCTCCTTCTTCCTCTTTTGGCTCTGCTCCCTGCCGGCCATCTGGTTCCCCGTC
CACAAGATCCGGCACCTGTTCACCGTCAAGGCCTACTTTGTGCCGCCGGCGGCGGTCGCGCTCCTGGTCTGGGCC
GTCGTCCGGGCCGGCGGCGCGGGCCCCGTCGTGCGGCAAGGCAACGCGGTCCACGGCAGCGAGCTGGCGTGGGAG
CTTGTCAAGGGCGTCATGTCGTCCATCGCCAACTTCTCGACGCTCATCATCAACGACTGCGACTTCTCGCGGTTC
GCGCGGCGGCCGCGGGACGCGCTGTGGTCCCAGCTGCTGGCCATCCCGCTCAGCTTCGGCCTGACGTCCTTCATC
GGCATCTTCGTCTCGTCGGCGTCGAGCCTGATGTACGGCGAGCCCGTGTGGGACCCACTGAGGCTGCTGGAGCGG
TTCATCGACGACGGCGGCCCGGCGCAGCGGTTCGGCGTCTTCGTCATCGCCCTGGCCTTCGCCCTGGCCCAGCTC
GGCACCAACATCGCGGCCAACTCGGTCTCGGCCGGGTCCGACATGGCGGCGCTGCTGCCACGCTACATCGACATC
CGGCGCGGCGGCTACGTCTGCGCCGCCGTCGGCCTGGCCATGTGCCCGTACAACCTGCTGACCGACGCGAACCGG
TTCACGACGTACCTGTCGGCCTACAGCGTCTTCCTCAGCTCCATCGCCGGCGTCATGGTCGCCGACTACTACCTC
GTCCGCCGGGGCTTCCTCGACGTGGCCGAGCTGTACGACGGCCACCGCGCGGGGCCGTACTTTTACACGGCGGGC
GTCCACTGGCGCGCCTACGCCGCCTACGTCGCCGGCATCCTGATCAACGTCGTCGGCTTCGCCGGCGCCGTCGGC
GCCGACGTGCCCCGGGGGGCCGTCTACCTCTTCAACCTCAACTTCTTTTGCGGCTTCGCCGTCTCGTCGGCCACG
TACTGGGGCCTGTGCCGACTGAGTCCCATCCCCGCCACGAGCGAGCGCTGGATGGAGGTGGGAGGGGGCGGGGAC
GACGACGAGCGCGCGGGCTTCGACCGCGACAGCGACCAATACGACGAGGAGCAGATGGCCAGCGCCAAGAGCGAG
CGGTTCAAGACGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail