Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6227
Gene name
LocationContig_317:23065..23514
Strand+
Gene length (bp)449
Transcript length (bp)288
Coding sequence length (bp)288
Protein length (aa) 96

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 3.2E-07 20 57

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9F131|3HBH1_PSEAC 3-hydroxybenzoate 6-hydroxylase 1 OS=Pseudomonas alcaligenes GN=xlnD PE=1 SV=1 17 72 3.0E-08
sp|Q53552|NHG2_PSEPU Salicylate hydroxylase OS=Pseudomonas putida GN=nahG PE=4 SV=1 16 72 1.0E-07
sp|B6D1N4|HPXO_KLEPN FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae GN=hpxO PE=3 SV=1 16 72 2.0E-06
sp|A6T923|HPXO_KLEP7 FAD-dependent urate hydroxylase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=hpxO PE=1 SV=1 16 72 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 15 34 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6227
MGSRDDTAAAGDPRGLRVAIIGAGMGGLASALALAKKGFRDIDVYESASGLGFVGAGIQLAPNLARILARLGCWD
GIAAEATEVLETSIRGTRPE*
Coding >Hirsu2|6227
ATGGGCTCTCGCGATGACACCGCGGCAGCGGGGGACCCGAGGGGGCTGCGCGTCGCCATCATCGGAGCGGGCATG
GGCGGCCTCGCGAGCGCGCTGGCACTGGCCAAGAAGGGCTTCCGCGACATCGACGTCTACGAGAGCGCCTCGGGC
CTGGGCTTCGTCGGGGCCGGCATCCAGCTGGCGCCCAACCTGGCGCGGATCCTGGCGCGGCTGGGCTGCTGGGAC
GGCATCGCGGCGGAGGCGACGGAGGTGCTGGAGACAAGCATCAGGGGTACGAGGCCCGAGTGA
Transcript >Hirsu2|6227
ATGGGCTCTCGCGATGACACCGCGGCAGCGGGGGACCCGAGGGGGCTGCGCGTCGCCATCATCGGAGCGGGCATG
GGCGGCCTCGCGAGCGCGCTGGCACTGGCCAAGAAGGGCTTCCGCGACATCGACGTCTACGAGAGCGCCTCGGGC
CTGGGCTTCGTCGGGGCCGGCATCCAGCTGGCGCCCAACCTGGCGCGGATCCTGGCGCGGCTGGGCTGCTGGGAC
GGCATCGCGGCGGAGGCGACGGAGGTGCTGGAGACAAGCATCAGGGGTACGAGGCCCGAGTGA
Gene >Hirsu2|6227
ATGGGCTCTCGCGATGACACCGCGGCAGCGGGGGACCCGAGGGGGCTGCGCGTCGCCATCATCGGAGCGGGTAAG
CGAAGTCCGAGTGAGGGTAGAGGGAGGAGGCGGAGGCGGAGGGCAGCGATATATAGAGAAGAAGAGAGAAGAGAC
TTGCCCCCCCCCCCCCCTTTTCCTCCTCCTGTGGAATCCGAAGTGGGCTGGCCGTGGGCTGACGACGAGGCTTGG
CGACAGGCATGGGCGGCCTCGCGAGCGCGCTGGCACTGGCCAAGAAGGGCTTCCGCGACATCGACGTCTACGAGA
GCGCCTCGGGCCTGGGCTTCGTCGGGGCCGGCATCCAGCTGGCGCCCAACCTGGCGCGGATCCTGGCGCGGCTGG
GCTGCTGGGACGGCATCGCGGCGGAGGCGACGGAGGTGCTGGAGACAAGCATCAGGGGTACGAGGCCCGAGTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail