Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6225
Gene name
LocationContig_317:15441..17171
Strand-
Gene length (bp)1730
Transcript length (bp)1425
Coding sequence length (bp)1425
Protein length (aa) 475

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 4.0E-36 74 449
PF00083 Sugar_tr Sugar (and other) transporter 1.3E-10 81 238
PF06609 TRI12 Fungal trichothecene efflux pump (TRI12) 2.2E-07 69 234

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 30 455 2.0E-24
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 50 451 2.0E-24
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 30 455 4.0E-24
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 34 249 1.0E-22
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 48 424 4.0E-20
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 30 455 2.0E-24
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 50 451 2.0E-24
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 30 455 4.0E-24
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 34 249 1.0E-22
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 48 424 4.0E-20
sp|Q9Y7S4|YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC569.05c PE=3 SV=1 8 382 4.0E-18
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 50 445 6.0E-18
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 8 442 6.0E-18
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 48 424 1.0E-17
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 17 445 1.0E-16
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 1 243 1.0E-16
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 7 455 2.0E-16
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 52 242 3.0E-16
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 37 455 3.0E-16
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 7 433 4.0E-16
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 36 441 4.0E-16
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 42 230 5.0E-16
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 1 436 8.0E-16
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 10 338 1.0E-15
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 28 369 1.0E-15
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 7 441 5.0E-15
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 4 242 6.0E-15
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 50 385 1.0E-14
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 50 345 1.0E-13
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 25 424 1.0E-13
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 22 247 2.0E-13
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 48 455 5.0E-13
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 50 410 7.0E-13
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 50 410 7.0E-13
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 28 433 2.0E-12
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 86 250 2.0E-11
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 19 242 5.0E-11
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 108 441 2.0E-10
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 40 243 8.0E-10
sp|P37597|YDHC_ECOLI Inner membrane transport protein YdhC OS=Escherichia coli (strain K12) GN=ydhC PE=1 SV=3 86 243 1.0E-09
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 93 442 5.0E-09
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 83 266 5.0E-09
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 8 245 9.0E-09
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 27 237 2.0E-08
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 50 224 4.0E-08
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 108 441 7.0E-08
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 63 223 1.0E-07
sp|P96709|YDGK_BACSU Uncharacterized MFS-type transporter YdgK OS=Bacillus subtilis (strain 168) GN=ydgK PE=3 SV=1 55 209 1.0E-07
sp|O34307|YVMA_BACSU Uncharacterized MFS-type transporter YvmA OS=Bacillus subtilis (strain 168) GN=yvmA PE=3 SV=1 59 225 2.0E-07
sp|O52733|XYLT_LACBR D-xylose-proton symporter OS=Lactobacillus brevis GN=xylT PE=3 SV=1 73 226 2.0E-07
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 61 244 3.0E-07
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 68 246 5.0E-06
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 68 246 5.0E-06
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 54 223 7.0E-06
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 54 223 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0051179 localization No
GO:0003674 molecular_function No
GO:0051234 establishment of localization No
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 66 88 22
2 98 120 22
3 133 155 22
4 160 182 22
5 189 211 22
6 216 238 22
7 288 310 22
8 325 347 22
9 368 386 18
10 401 423 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6225
MNAKGFTSEQKIETVGDDLASESGLLGEDHRQYLLRRHGTVDLDPVPQMDDDDPLNWPRKKKLLNLALVSFHAMM
FSFTAAAIQCAFVEIAADLQVSVQQTSYLTSLFIAITGSATLLWGPLSHTFGRRPIFLLSLFCAMLGNIGCALSP
SYGTMALCRAITSFFISPAAALGSGVVSEVFFKKERGRFMGIWTVMITVGVPISPLVFGFVAQRVSYRWIYWILA
ITNGVQVILHFFLGSETRYEPGIAPPAYTSAITRHVGFRRIDPTPLTWFEFVRPLTYFAHKCVAMATIAYAMVFL
WGSIMTTLEIPQIFPKKFGLNIQEVGLQNIGIIIGTLIGEQIGGLSSDKWMFMHERKHGKPADPEFRLWLSHIGY
LLTMAGVIVFLVQLDHASNKWNVTPVIGAGIAAAGNQVVTTIMVTYAVDCNPKDAAAIGGFINFVRQTWGFIGPF
WYVSLPCRGVPVITCLRNANPAAD*
Coding >Hirsu2|6225
ATGAACGCCAAAGGCTTCACCTCCGAGCAGAAGATAGAGACGGTCGGGGATGATCTCGCTAGCGAGAGCGGTCTG
TTGGGCGAGGATCACCGGCAGTATCTTCTGCGGCGCCATGGAACGGTCGATCTGGATCCCGTCCCGCAGATGGAC
GACGACGATCCCCTGAACTGGCCACGGAAGAAGAAACTCCTGAACCTCGCGCTGGTGTCCTTCCACGCCATGATG
TTCTCCTTCACCGCCGCCGCCATACAATGCGCCTTCGTCGAGATCGCGGCGGACCTGCAGGTCAGCGTCCAGCAG
ACGAGCTACCTCACCTCGCTCTTCATCGCCATCACCGGCTCCGCCACCCTGCTCTGGGGGCCGCTCTCACACACC
TTCGGCCGCCGGCCCATCTTCCTGCTGTCCCTGTTCTGCGCCATGCTCGGCAACATCGGCTGCGCCCTGAGCCCT
TCGTACGGGACCATGGCCCTGTGCCGCGCCATCACCTCCTTTTTCATCAGCCCGGCCGCCGCCCTGGGCAGCGGC
GTCGTGTCCGAGGTTTTCTTCAAGAAGGAGAGGGGCCGCTTCATGGGCATCTGGACCGTCATGATCACCGTCGGC
GTCCCGATATCGCCCCTGGTCTTTGGTTTCGTCGCGCAGCGGGTCAGCTACCGATGGATCTACTGGATTCTGGCC
ATCACAAACGGCGTCCAGGTCATCCTCCACTTCTTCCTCGGCTCCGAAACGAGATACGAGCCCGGGATCGCGCCC
CCGGCTTACACGTCTGCCATCACGCGCCACGTCGGCTTTCGTCGCATCGATCCGACGCCCCTCACCTGGTTCGAG
TTCGTCCGGCCACTGACGTACTTTGCACACAAGTGCGTCGCCATGGCCACCATCGCATACGCCATGGTCTTCCTC
TGGGGCAGCATCATGACCACGCTGGAGATTCCCCAGATCTTCCCCAAGAAGTTCGGCCTCAACATTCAGGAAGTC
GGCCTCCAGAACATCGGCATCATCATCGGCACTCTCATCGGCGAGCAGATCGGCGGCTTGTCCTCCGACAAGTGG
ATGTTCATGCACGAGCGCAAGCACGGCAAGCCAGCCGACCCGGAGTTCCGGCTCTGGCTCAGCCATATCGGCTAT
CTTCTCACCATGGCCGGCGTCATCGTCTTCCTGGTCCAGCTCGACCACGCATCCAATAAGTGGAACGTCACGCCG
GTGATAGGAGCGGGCATCGCCGCGGCTGGCAACCAGGTCGTTACCACCATCATGGTCACGTATGCCGTCGACTGT
AATCCAAAGGACGCCGCGGCCATCGGAGGTTTCATCAACTTCGTCCGCCAGACATGGGGTTTCATCGGGCCGTTC
TGGTACGTGTCACTGCCCTGTAGGGGCGTTCCTGTCATCACATGCCTGCGGAATGCTAACCCAGCTGCCGACTAG
Transcript >Hirsu2|6225
ATGAACGCCAAAGGCTTCACCTCCGAGCAGAAGATAGAGACGGTCGGGGATGATCTCGCTAGCGAGAGCGGTCTG
TTGGGCGAGGATCACCGGCAGTATCTTCTGCGGCGCCATGGAACGGTCGATCTGGATCCCGTCCCGCAGATGGAC
GACGACGATCCCCTGAACTGGCCACGGAAGAAGAAACTCCTGAACCTCGCGCTGGTGTCCTTCCACGCCATGATG
TTCTCCTTCACCGCCGCCGCCATACAATGCGCCTTCGTCGAGATCGCGGCGGACCTGCAGGTCAGCGTCCAGCAG
ACGAGCTACCTCACCTCGCTCTTCATCGCCATCACCGGCTCCGCCACCCTGCTCTGGGGGCCGCTCTCACACACC
TTCGGCCGCCGGCCCATCTTCCTGCTGTCCCTGTTCTGCGCCATGCTCGGCAACATCGGCTGCGCCCTGAGCCCT
TCGTACGGGACCATGGCCCTGTGCCGCGCCATCACCTCCTTTTTCATCAGCCCGGCCGCCGCCCTGGGCAGCGGC
GTCGTGTCCGAGGTTTTCTTCAAGAAGGAGAGGGGCCGCTTCATGGGCATCTGGACCGTCATGATCACCGTCGGC
GTCCCGATATCGCCCCTGGTCTTTGGTTTCGTCGCGCAGCGGGTCAGCTACCGATGGATCTACTGGATTCTGGCC
ATCACAAACGGCGTCCAGGTCATCCTCCACTTCTTCCTCGGCTCCGAAACGAGATACGAGCCCGGGATCGCGCCC
CCGGCTTACACGTCTGCCATCACGCGCCACGTCGGCTTTCGTCGCATCGATCCGACGCCCCTCACCTGGTTCGAG
TTCGTCCGGCCACTGACGTACTTTGCACACAAGTGCGTCGCCATGGCCACCATCGCATACGCCATGGTCTTCCTC
TGGGGCAGCATCATGACCACGCTGGAGATTCCCCAGATCTTCCCCAAGAAGTTCGGCCTCAACATTCAGGAAGTC
GGCCTCCAGAACATCGGCATCATCATCGGCACTCTCATCGGCGAGCAGATCGGCGGCTTGTCCTCCGACAAGTGG
ATGTTCATGCACGAGCGCAAGCACGGCAAGCCAGCCGACCCGGAGTTCCGGCTCTGGCTCAGCCATATCGGCTAT
CTTCTCACCATGGCCGGCGTCATCGTCTTCCTGGTCCAGCTCGACCACGCATCCAATAAGTGGAACGTCACGCCG
GTGATAGGAGCGGGCATCGCCGCGGCTGGCAACCAGGTCGTTACCACCATCATGGTCACGTATGCCGTCGACTGT
AATCCAAAGGACGCCGCGGCCATCGGAGGTTTCATCAACTTCGTCCGCCAGACATGGGGTTTCATCGGGCCGTTC
TGGTACGTGTCACTGCCCTGTAGGGGCGTTCCTGTCATCACATGCCTGCGGAATGCTAACCCAGCTGCCGACTAG
Gene >Hirsu2|6225
ATGAACGCCAAAGGCTTCACCTCCGAGCAGAAGATAGAGACGGTCGGGGATGATCTCGCTGTAAGTGCCGACCGT
CGGATCCAGAACCAGGCCACAGTCCCGGTGTGTGCGTGTGCGTGTGCGTGTGCGTGTGTTTTTGTGTGCTCGATG
CATTCTCCTCGCTGCCGAGGCTGACCAGGGCCGGCTTCGTGTTTCCATCCAGAGCGAGAGCGGTCTGTTGGGCGA
GGATCACCGGCAGTATCTTCTGCGGCGCCATGGAACGGTCGATCTGGATCCCGTCCCGCAGATGGACGACGACGA
TCCCCTGAACTGGCCACGGAAGAAGGTGAGCGAGCAGCCTCGTCCCGCTTCGCGCGAAGCCGGTGCTGAGTCGGG
CCCGGGCGACAGAAACTCCTGAACCTCGCGCTGGTGTCCTTCCACGCCATGATGTTCTCCTTCACCGCCGCCGCC
ATACAATGCGCCTTCGTCGAGATCGCGGCGGACCTGCAGGTCAGCGTCCAGCAGACGAGCTACCTCACCTCGCTC
TTCATCGCCATCACCGGCTCCGCCACCCTGCTCTGGGGGCCGCTCTCACACACCTTCGGCCGCCGGCCCATCTTC
CTGCTGTCCCTGTTCTGCGCCATGCTCGGCAACATCGGCTGCGCCCTGAGCCCTTCGTACGGGACCATGGCCCTG
TGCCGCGCCATCACCTCCTTTTTCATCAGCCCGGCCGCCGCCCTGGGCAGCGGCGTCGTGTCCGAGGTTTTCTTC
AAGAAGGAGAGGGGCCGCTTCATGGGCATCTGGACCGTCATGATCACCGTCGGCGTCCCGATATCGCCCCTGGTC
TTTGGTTTCGTCGCGCAGCGGGTCAGCTACCGATGGATCTACTGGATTCTGGCCATCGTAAGACCCCCCTTGAAC
GCTCGACGGCGGCTGCGATCCCTTCCCCGTCTCGTCGTCATCGTCGTCTTTTCACGTCCTCGTCTAATCTTGGGG
GTATGCAGACAAACGGCGTCCAGGTCATCCTCCACTTCTTCCTCGGCTCCGAAACGAGATACGAGCCCGGGATCG
CGCCCCCGGCTTACACGTCTGCCATCACGCGCCACGTCGGCTTTCGTCGCATCGATCCGACGCCCCTCACCTGGT
TCGAGTTCGTCCGGCCACTGACGTACTTTGCACACAAGTGCGTCGCCATGGCCACCATCGCATACGCCATGGTCT
TCCTCTGGGGCAGCATCATGACCACGCTGGAGATTCCCCAGATCTTCCCCAAGAAGTTCGGCCTCAACATTCAGG
AAGTCGGCCTCCAGAACATCGGCATCATCATCGGCACTCTCATCGGCGAGCAGATCGGCGGCTTGTCCTCCGACA
AGTGGATGTTCATGCACGAGCGCAAGCACGGCAAGCCAGCCGACCCGGAGTTCCGGCTCTGGCTCAGCCATATCG
GCTATCTTCTCACCATGGCCGGCGTCATCGTCTTCCTGGTCCAGCTCGACCACGCATCCAATAAGTGGAACGTCA
CGCCGGTGATAGGAGCGGGCATCGCCGCGGCTGGCAACCAGGTCGTTACCACCATCATGGTCACGTATGCCGTCG
ACTGTAATCCAAAGGACGCCGCGGCCATCGGAGGTTTCATCAACTTCGTCCGCCAGACATGGGGTTTCATCGGGC
CGTTCTGGTACGTGTCACTGCCCTGTAGGGGCGTTCCTGTCATCACATGCCTGCGGAATGCTAACCCAGCTGCCG
ACTAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail