Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6211
Gene name
LocationContig_316:19245..20428
Strand-
Gene length (bp)1183
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03878 YIF1 YIF1 4.3E-99 68 320

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87148|YIF1_SCHPO Protein transport protein yif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrf1 PE=3 SV=1 10 320 8.0E-79
sp|Q4FZQ0|YF1BB_XENLA Protein YIF1B-B OS=Xenopus laevis GN=yif1b-b PE=2 SV=1 66 320 5.0E-45
sp|Q3T196|YIF1A_BOVIN Protein YIF1A OS=Bos taurus GN=YIF1A PE=2 SV=1 27 284 2.0E-44
sp|Q6GN58|YF1BA_XENLA Protein YIF1B-A OS=Xenopus laevis GN=yif1b-a PE=2 SV=1 66 320 3.0E-44
sp|Q6P301|YIF1B_XENTR Protein YIF1B OS=Xenopus tropicalis GN=yif1b PE=2 SV=1 66 320 1.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87148|YIF1_SCHPO Protein transport protein yif1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrf1 PE=3 SV=1 10 320 8.0E-79
sp|Q4FZQ0|YF1BB_XENLA Protein YIF1B-B OS=Xenopus laevis GN=yif1b-b PE=2 SV=1 66 320 5.0E-45
sp|Q3T196|YIF1A_BOVIN Protein YIF1A OS=Bos taurus GN=YIF1A PE=2 SV=1 27 284 2.0E-44
sp|Q6GN58|YF1BA_XENLA Protein YIF1B-A OS=Xenopus laevis GN=yif1b-a PE=2 SV=1 66 320 3.0E-44
sp|Q6P301|YIF1B_XENTR Protein YIF1B OS=Xenopus tropicalis GN=yif1b PE=2 SV=1 66 320 1.0E-43
sp|Q5U3G6|YIF1B_DANRE Protein YIF1B OS=Danio rerio GN=yif1b PE=2 SV=2 23 320 2.0E-43
sp|Q6PC24|YIF1A_DANRE Protein YIF1A OS=Danio rerio GN=yif1a PE=2 SV=1 21 287 4.0E-42
sp|Q5BJH7|YIF1B_HUMAN Protein YIF1B OS=Homo sapiens GN=YIF1B PE=1 SV=1 33 320 2.0E-41
sp|O95070|YIF1A_HUMAN Protein YIF1A OS=Homo sapiens GN=YIF1A PE=1 SV=2 27 284 2.0E-40
sp|Q9CX30|YIF1B_MOUSE Protein YIF1B OS=Mus musculus GN=Yif1b PE=1 SV=2 66 320 2.0E-39
sp|Q91XB7|YIF1A_MOUSE Protein YIF1A OS=Mus musculus GN=Yif1a PE=1 SV=1 30 284 6.0E-36
sp|P53845|YIF1_YEAST Protein transport protein YIF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIF1 PE=1 SV=1 33 319 1.0E-30
sp|Q6PEC3|YIF1B_RAT Protein YIF1B OS=Rattus norvegicus GN=Yif1b PE=2 SV=2 66 187 7.0E-20
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 159 178 19
2 193 215 22
3 222 244 22
4 248 270 22
5 303 320 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6211
MQRASYGQSPPLHHPVPQHVSSVPQLRSPPPPTGSAQSQQQAYGGTPYQQQGAAAAGNAFGGYGQFMNDPTAQVA
AQFGQTAFKHGQEYVEQNFGRYVNVSALKHYFNVSNFYVVNKLFLVLFPWRHKPWSRKQAVGANGQEGWYLPPRE
DINSPDMYIPVMALVTYILLSTLIAGLGGKFQPELLGYTATRGLVVVIVEIIALKLGCYLLSISSQSQLLDLIAY
SGYKFVGIIATIAIAQVVNGGKGTGGVAGWTVFVYTFLATSFFLMRSLKYVLLPETSGGTGGPMQTDSRAKRNQR
TQFLFFYSYAVQGFFMGMLTSS*
Coding >Hirsu2|6211
ATGCAACGGGCGTCGTACGGGCAGTCGCCCCCGTTGCACCACCCGGTGCCCCAGCACGTTTCGTCGGTCCCCCAG
CTCCGGTCGCCGCCGCCGCCGACGGGCTCGGCCCAGTCGCAACAGCAGGCCTATGGCGGGACACCCTACCAGCAG
CAGGGCGCCGCGGCGGCCGGCAACGCCTTTGGCGGCTACGGCCAGTTCATGAACGACCCGACCGCTCAGGTGGCT
GCCCAGTTCGGCCAGACGGCCTTCAAGCACGGCCAGGAATACGTGGAGCAAAATTTCGGCCGCTATGTCAACGTC
TCTGCCCTCAAGCACTACTTCAACGTCTCCAACTTCTACGTCGTCAACAAGCTCTTCCTCGTCCTCTTCCCTTGG
AGGCACAAGCCTTGGTCGCGCAAGCAAGCTGTCGGCGCCAACGGCCAGGAGGGATGGTATCTGCCTCCGCGAGAG
GACATCAACAGTCCTGACATGTACATCCCAGTCATGGCCCTGGTCACGTACATTCTCTTGTCGACACTCATCGCC
GGGCTGGGAGGCAAATTCCAGCCGGAACTGCTGGGATATACGGCAACGCGAGGGCTGGTGGTGGTCATTGTCGAG
ATCATTGCGCTTAAGCTCGGCTGTTACCTGTTGAGCATCTCGAGCCAGTCCCAACTCCTCGACCTCATTGCCTAC
TCCGGGTACAAGTTTGTCGGTATCATCGCCACCATCGCCATTGCCCAGGTTGTCAACGGCGGCAAGGGCACGGGT
GGCGTGGCTGGTTGGACCGTTTTCGTCTACACCTTTTTGGCCACCTCCTTCTTTCTTATGCGGTCCCTGAAATAC
GTCCTACTGCCAGAGACATCTGGGGGTACAGGCGGCCCCATGCAAACCGACTCACGGGCGAAGCGGAACCAGCGG
ACCCAGTTTCTCTTTTTTTACTCATACGCCGTCCAGGGCTTCTTCATGGGGATGCTCACCTCGTCTTGA
Transcript >Hirsu2|6211
ATGCAACGGGCGTCGTACGGGCAGTCGCCCCCGTTGCACCACCCGGTGCCCCAGCACGTTTCGTCGGTCCCCCAG
CTCCGGTCGCCGCCGCCGCCGACGGGCTCGGCCCAGTCGCAACAGCAGGCCTATGGCGGGACACCCTACCAGCAG
CAGGGCGCCGCGGCGGCCGGCAACGCCTTTGGCGGCTACGGCCAGTTCATGAACGACCCGACCGCTCAGGTGGCT
GCCCAGTTCGGCCAGACGGCCTTCAAGCACGGCCAGGAATACGTGGAGCAAAATTTCGGCCGCTATGTCAACGTC
TCTGCCCTCAAGCACTACTTCAACGTCTCCAACTTCTACGTCGTCAACAAGCTCTTCCTCGTCCTCTTCCCTTGG
AGGCACAAGCCTTGGTCGCGCAAGCAAGCTGTCGGCGCCAACGGCCAGGAGGGATGGTATCTGCCTCCGCGAGAG
GACATCAACAGTCCTGACATGTACATCCCAGTCATGGCCCTGGTCACGTACATTCTCTTGTCGACACTCATCGCC
GGGCTGGGAGGCAAATTCCAGCCGGAACTGCTGGGATATACGGCAACGCGAGGGCTGGTGGTGGTCATTGTCGAG
ATCATTGCGCTTAAGCTCGGCTGTTACCTGTTGAGCATCTCGAGCCAGTCCCAACTCCTCGACCTCATTGCCTAC
TCCGGGTACAAGTTTGTCGGTATCATCGCCACCATCGCCATTGCCCAGGTTGTCAACGGCGGCAAGGGCACGGGT
GGCGTGGCTGGTTGGACCGTTTTCGTCTACACCTTTTTGGCCACCTCCTTCTTTCTTATGCGGTCCCTGAAATAC
GTCCTACTGCCAGAGACATCTGGGGGTACAGGCGGCCCCATGCAAACCGACTCACGGGCGAAGCGGAACCAGCGG
ACCCAGTTTCTCTTTTTTTACTCATACGCCGTCCAGGGCTTCTTCATGGGGATGCTCACCTCGTCTTGA
Gene >Hirsu2|6211
ATGCAACGGGCGTCGTACGGGCAGTCGCCCCCGTTGCACCACCCGGTGCCCCAGCACGTTTCGTCGGTCCCCCAG
CTCCGGTCGCCGCCGCCGCCGACGGGCTCGGCCCAGTCGCAACAGCAGGCCTATGGCGGGACACCCTACCAGCAG
CAGGGCGCCGCGGCGGCCGGCAACGCCTTTGGCGGCTACGGCCAGTTCATGAACGACCCGACCGCTCAGGTGGCT
GCCCAGTTCGGCCAGACGGCCTTCAAGCACGGCCAGGAATACGTGGAGCAAAATGTTGGTCGCGACGCCCTGGGT
CCCGGGCCTCTTTTGCCCTTGACCGCATCACTCTAACCCAGCCCCCCTTTGCAGTTCGGCCGCTATGTCAACGTC
TCTGCCCTCAAGCACTACTTCAACGTCTCCAACTTCTACGTCGTCAACAAGCTCTTCCTCGTCCTCTTCCCTTGG
AGGCACAAGCCTTGGTCGCGCAAGCAAGCTGTCGGCGCCAACGGCCAGGAGGGATGGTATCTGCCTCCGCGAGAG
GACATCAACAGTCCTGACATGTACATCCCAGGTCAGCAAGCTGTTTTCCGCACTCACCCACCCCCACCCCTCGCG
TGGCGCTGACAAACTCTCTCTCCAGTCATGGCCCTGGTCACGTACATTCTCTTGTCGACACTCATCGCCGGGCTG
GGAGGCAAATTCCAGCCGGAACTGCTGGGATATACGGCAACGCGAGGGCTGGTGGTGGTCATTGTCGAGATCATT
GCGCTTAAGCTCGGCTGTTACCTGTTGAGCATCTCGAGCCAGTCCCAACTCCTCGACCTCATTGCCTACTCCGGG
TACAAGTTTGTCGGTATCATCGCCACCATCGCCATTGCCCAGGTTGTCAACGGCGGCAAGGGCACGGGTGGCGTG
GCTGGTTGGACCGTTTTCGTCTACACCTTTTTGGCCACCTCCTTCTTTCTTGTAGGTGCTCTCACGCCCTCTCGG
CTCGTCGTCAGGCCGCTTGGTGCTTTCTGGCTAACAGACCTTCCAGATGCGGTCCCTGAAATACGTCCTACTGCC
AGAGACATCTGGGGGTACAGGCGGCCCCATGCAAACCGACTCACGGGCGAAGCGGAACCAGCGGACCCAGTTTCT
CTTTTTTTACTCATACGCCGTCCAGGGCTTCTTCATGGGGATGCTCACCTCGTCTTGA

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail