Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6210
Gene name
LocationContig_316:17672..18612
Strand-
Gene length (bp)940
Transcript length (bp)663
Coding sequence length (bp)663
Protein length (aa) 221

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04117 Mpv17_PMP22 Mpv17 / PMP22 family 3.5E-11 162 215

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0044425 membrane part No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 45 67 22
3 171 193 22
4 200 219 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6210
MATESGTSRAILAATLQAALLGCLSNVLAQLITASRNKTELAVDWIPVFQFLLFSIVSTPPNFLWQVFLESTYPA
HPPVRHRKKSDEAEAGRRAPLSVRNTAAKFALDQTVGAAVNTLLFSTFIHALQEAMAPAPRLTSLPAAVTYWTGP
GAVDFGRVRLDAVLDAARAEFWPIVVAGLKMWPAVSLLNFTVVKTVEARNLVGALAGVAWGIYMSMMAAA*
Coding >Hirsu2|6210
ATGGCGACTGAAAGCGGAACATCTCGCGCCATACTGGCCGCGACGCTGCAGGCGGCTCTGCTCGGCTGCCTGTCG
AACGTGCTGGCGCAGCTCATCACGGCCAGCAGGAACAAGACCGAGCTGGCCGTCGACTGGATACCCGTCTTCCAA
TTCCTGCTCTTCAGCATCGTCAGCACGCCTCCCAACTTCCTCTGGCAAGTGTTTCTAGAGTCGACGTACCCGGCG
CACCCGCCGGTGCGCCACCGCAAGAAGTCGGACGAGGCCGAGGCCGGGCGGCGCGCGCCGCTGTCGGTGCGCAAC
ACGGCGGCCAAGTTCGCGCTGGACCAGACGGTCGGGGCGGCCGTCAACACGCTGCTCTTCAGCACCTTCATCCAC
GCCCTGCAGGAGGCCATGGCGCCGGCGCCGCGCCTCACCAGCCTGCCGGCGGCCGTCACTTACTGGACCGGCCCG
GGGGCCGTCGACTTTGGGCGCGTGCGCCTCGACGCGGTCCTCGACGCCGCGCGCGCTGAGTTCTGGCCCATCGTC
GTCGCCGGCCTCAAGATGTGGCCCGCCGTGAGCCTGCTGAACTTTACCGTCGTCAAGACGGTCGAGGCCCGCAAC
CTGGTCGGTGCCCTGGCCGGCGTGGCGTGGGGCATCTACATGAGCATGATGGCGGCCGCATAG
Transcript >Hirsu2|6210
ATGGCGACTGAAAGCGGAACATCTCGCGCCATACTGGCCGCGACGCTGCAGGCGGCTCTGCTCGGCTGCCTGTCG
AACGTGCTGGCGCAGCTCATCACGGCCAGCAGGAACAAGACCGAGCTGGCCGTCGACTGGATACCCGTCTTCCAA
TTCCTGCTCTTCAGCATCGTCAGCACGCCTCCCAACTTCCTCTGGCAAGTGTTTCTAGAGTCGACGTACCCGGCG
CACCCGCCGGTGCGCCACCGCAAGAAGTCGGACGAGGCCGAGGCCGGGCGGCGCGCGCCGCTGTCGGTGCGCAAC
ACGGCGGCCAAGTTCGCGCTGGACCAGACGGTCGGGGCGGCCGTCAACACGCTGCTCTTCAGCACCTTCATCCAC
GCCCTGCAGGAGGCCATGGCGCCGGCGCCGCGCCTCACCAGCCTGCCGGCGGCCGTCACTTACTGGACCGGCCCG
GGGGCCGTCGACTTTGGGCGCGTGCGCCTCGACGCGGTCCTCGACGCCGCGCGCGCTGAGTTCTGGCCCATCGTC
GTCGCCGGCCTCAAGATGTGGCCCGCCGTGAGCCTGCTGAACTTTACCGTCGTCAAGACGGTCGAGGCCCGCAAC
CTGGTCGGTGCCCTGGCCGGCGTGGCGTGGGGCATCTACATGAGCATGATGGCGGCCGCATAG
Gene >Hirsu2|6210
ATGGCGACTGAAAGCGGAACATCTCGCGCCATACTGGCCGCGACGCTGCAGGCGGCTCTGCTCGGCTGCCTGTCG
AACGTGCTGGCGCAGCTCATCACGGCCAGCAGGAACAAGGTGAGTCGGGGCCAGCAATCCGGGCTCCCAGGCCCC
CTCGGCTCTCCAGACCGTCCGTCTGCTGACTCTGCCTCGTCTGCGTGCGCGGCTCCGGGCGGGATGCAGACCGAG
CTGGCCGTCGACTGGATACCCGTCTTCCAATTCCTGCTCTTCAGCATCGTCAGCACGCCTCCCAACTTCCTCTGG
TGAGCCTCCGGCCTCGTCCCCTCCCGTCGCGGCCCCCCGCCAGCCAGACATTCGGTTGCTCATCATCGGAGACNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCCCCCCCCCCCCCCCTTTGT
CTCTCTCCCGCCTCCCGTCAGGCAAGTGTTTCTAGAGTCGACGTACCCGGCGCACCCGCCGGTGCGCCACCGCAA
GAAGTCGGACGAGGCCGAGGCCGGGCGGCGCGCGCCGCTGTCGGTGCGCAACACGGCGGCCAAGTTCGCGCTGGA
CCAGACGGTCGGGGCGGCCGTCAACACGCTGCTCTTCAGCACCTTCATCCACGCCCTGCAGGAGGCCATGGCGCC
GGCGCCGCGCCTCACCAGCCTGCCGGCGGCCGTCACTTACTGGACCGGCCCGGGGGCCGTCGACTTTGGGCGCGT
GCGCCTCGACGCGGTCCTCGACGCCGCGCGCGCTGAGTTCTGGCCCATCGTCGTCGCCGGCCTCAAGATGTGGCC
CGCCGTGAGCCTGCTGAACTTTACCGTCGTCAAGACGGTCGAGGCCCGCAACCTGGTCGGTGCCCTGGCCGGCGT
GGCGTGGGGCATCTACATGAGCATGATGGCGGCCGCATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail