Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6204
Gene name
LocationContig_316:206..6685
Strand-
Gene length (bp)6479
Transcript length (bp)5862
Coding sequence length (bp)5862
Protein length (aa) 1954

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 1.3E-71 2 252
PF00698 Acyl_transf_1 Acyl transferase domain 9.6E-51 554 846
PF14765 PS-DH Polyketide synthase dehydratase 5.3E-47 937 1231
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 1.1E-36 261 377
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 7.7E-19 381 522
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 6.2E-09 1783 1873

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 4 1181 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 4 1255 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 4 1196 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 4 1196 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 4 1166 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 4 1181 0.0E+00
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 4 1255 0.0E+00
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 4 1196 0.0E+00
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 4 1196 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 4 1166 0.0E+00
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 4 1161 3.0E-138
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 4 1161 3.0E-138
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 4 1161 9.0E-138
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 4 847 9.0E-136
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 4 847 3.0E-134
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 4 847 4.0E-134
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 2 1197 1.0E-131
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 4 927 6.0E-131
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 4 927 7.0E-131
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 4 927 7.0E-131
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 2 1197 9.0E-130
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 4 1181 7.0E-128
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 4 1181 7.0E-128
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 4 1181 7.0E-128
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 4 1181 7.0E-128
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 4 1181 1.0E-127
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 3 1162 4.0E-127
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 4 1159 9.0E-126
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 2 1162 2.0E-123
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 4 1161 3.0E-123
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 2 1135 5.0E-123
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 4 1159 7.0E-123
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 4 1159 2.0E-120
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 4 919 4.0E-120
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1 989 5.0E-119
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 4 1161 5.0E-119
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 4 1161 5.0E-119
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 4 918 1.0E-118
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 3 1159 1.0E-118
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 2 995 1.0E-118
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 3 1147 3.0E-118
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 2 1135 3.0E-118
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 4 1158 5.0E-118
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 2 837 6.0E-117
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 3 1158 2.0E-116
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 5 1158 5.0E-116
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 2 1128 3.0E-115
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 2 1158 6.0E-115
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 2 1158 9.0E-115
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 3 1158 1.0E-114
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 3 1157 3.0E-114
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 2 1130 1.0E-113
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 2 1158 2.0E-113
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 4 1130 3.0E-113
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 4 1130 6.0E-113
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 4 1128 3.0E-112
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 4 1130 2.0E-111
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 2 1181 6.0E-111
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1 987 6.0E-111
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 4 919 3.0E-110
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 4 919 2.0E-109
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 4 928 2.0E-109
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 3 1168 1.0E-108
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 2 1130 2.0E-108
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 2 1181 6.0E-108
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1 1293 1.0E-107
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 3 1168 2.0E-107
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 3 1168 3.0E-107
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 2 1133 3.0E-107
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 2 919 1.0E-106
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 4 1158 8.0E-106
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 3 1154 1.0E-105
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 11 1135 3.0E-105
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1 1116 4.0E-102
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 4 987 1.0E-101
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 69 1159 3.0E-101
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 69 1116 2.0E-100
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 2 987 5.0E-100
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1 1123 2.0E-98
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 4 424 3.0E-98
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 4 918 3.0E-96
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 4 923 5.0E-92
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 4 923 5.0E-92
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 4 923 5.0E-92
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 4 937 4.0E-89
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 818 8.0E-87
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 2 531 1.0E-82
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 4 536 3.0E-80
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 3 536 2.0E-79
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 4 417 6.0E-78
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 2 529 2.0E-77
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 3 426 4.0E-74
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 4 529 3.0E-72
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 3 536 2.0E-71
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 2 426 3.0E-70
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 4 532 9.0E-70
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 2 426 9.0E-69
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 1 369 2.0E-63
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 4 426 3.0E-63
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 2 530 4.0E-60
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 4 530 6.0E-60
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 2 425 2.0E-54
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2 614 2.0E-54
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 4 425 2.0E-53
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2 426 8.0E-53
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 2 565 9.0E-50
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 550 1141 3.0E-32
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 548 1226 9.0E-31
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 66 424 7.0E-26
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 511 909 9.0E-25
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 508 1159 2.0E-24
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 18 424 2.0E-23
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 4 424 1.0E-22
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 4 424 2.0E-22
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 150 426 3.0E-22
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 150 426 3.0E-22
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 150 426 3.0E-22
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 150 426 3.0E-22
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 66 424 4.0E-22
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 66 424 5.0E-22
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 150 426 2.0E-21
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 18 426 2.0E-21
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 64 420 3.0E-21
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 4 420 1.0E-20
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 43 422 1.0E-20
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 4 424 2.0E-20
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 64 420 3.0E-20
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 4 427 3.0E-20
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 4 424 5.0E-20
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1475 1871 7.0E-20
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 4 424 1.0E-19
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 150 424 2.0E-19
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 66 424 2.0E-19
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 71 426 3.0E-19
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 154 420 6.0E-19
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 4 424 2.0E-18
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 154 428 4.0E-18
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 161 424 5.0E-18
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 161 424 5.0E-18
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 110 424 7.0E-18
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 552 815 4.0E-17
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 157 426 5.0E-17
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 68 419 6.0E-17
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 150 424 7.0E-17
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 554 815 2.0E-16
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 552 1158 6.0E-16
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 80 424 6.0E-16
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 80 424 6.0E-16
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 55 427 8.0E-16
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 92 422 1.0E-15
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 172 426 1.0E-15
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 156 424 1.0E-15
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 92 422 2.0E-15
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 92 422 2.0E-15
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 92 422 2.0E-15
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 101 424 2.0E-15
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 80 424 2.0E-15
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 80 424 2.0E-15
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 80 424 2.0E-15
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 153 426 2.0E-15
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 80 424 3.0E-15
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1588 1849 2.0E-14
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 551 835 3.0E-14
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 551 768 5.0E-14
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 552 890 7.0E-14
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 61 424 1.0E-13
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 157 426 3.0E-13
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1644 1910 4.0E-13
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 157 426 4.0E-13
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1588 1849 5.0E-12
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1588 1849 5.0E-12
sp|P0C842|CJ052_HUMAN Putative uncharacterized protein encoded by LINC00614 OS=Homo sapiens GN=LINC00614 PE=5 SV=1 40 140 6.0E-12
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 161 424 2.0E-11
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 552 757 5.0E-10
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1621 1849 2.0E-09
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1621 1849 2.0E-09
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1621 1849 2.0E-09
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1621 1849 2.0E-09
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1621 1849 2.0E-09
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 552 820 2.0E-09
sp|A7Z4X8|BAEC_BACMF Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase BaeC OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeC PE=1 SV=1 552 757 7.0E-09
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1661 1892 8.0E-09
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1661 1905 9.0E-09
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 78 423 1.0E-08
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1750 1871 2.0E-08
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1695 1871 4.0E-08
sp|O13698|FABD_SCHPO Malonyl CoA-acyl carrier protein transacylase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mct1 PE=3 SV=1 553 770 5.0E-08
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 168 419 9.0E-08
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1750 1871 1.0E-07
sp|O34787|PKSE_BACSU Polyketide biosynthesis protein PksE OS=Bacillus subtilis (strain 168) GN=pksE PE=1 SV=3 552 768 1.0E-07
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1698 1871 2.0E-07
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1750 1871 2.0E-07
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1750 1871 2.0E-07
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1750 1871 2.0E-07
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1750 1871 3.0E-07
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 551 835 5.0E-07
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 551 835 5.0E-07
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 551 835 7.0E-07
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 551 835 7.0E-07
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 551 835 7.0E-07
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 551 835 9.0E-07
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 551 835 1.0E-06
sp|Q8R3F5|FABD_MOUSE Malonyl-CoA-acyl carrier protein transacylase, mitochondrial OS=Mus musculus GN=Mcat PE=1 SV=3 554 818 2.0E-06
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 168 419 3.0E-06
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 168 419 3.0E-06
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 168 419 3.0E-06
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 168 419 3.0E-06
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1655 1892 4.0E-06
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 551 729 5.0E-06
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 551 729 7.0E-06
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 551 729 7.0E-06
sp|P19097|FAS2_YEAST Fatty acid synthase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FAS2 PE=1 SV=2 282 431 1.0E-05
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6887 0.3839 0.0737 0.0346 0.216 0.0262 0.0656 0.1019 0.0488 0.0077

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 25 PKS

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup78
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4899
Ophiocordyceps australis map64 (Brazil) OphauB2|5634
Ophiocordyceps kimflemingae Ophio5|8256
Ophiocordyceps subramaniannii Hirsu2|9925
Ophiocordyceps subramaniannii Hirsu2|9186
Ophiocordyceps subramaniannii Hirsu2|8479
Ophiocordyceps subramaniannii Hirsu2|7364
Ophiocordyceps subramaniannii Hirsu2|6703
Ophiocordyceps subramaniannii Hirsu2|6204 (this protein)
Ophiocordyceps subramaniannii Hirsu2|11185
Ophiocordyceps subramaniannii Hirsu2|4298
Ophiocordyceps subramaniannii Hirsu2|3326
Ophiocordyceps subramaniannii Hirsu2|3276
Ophiocordyceps subramaniannii Hirsu2|3122
Ophiocordyceps subramaniannii Hirsu2|24
Ophiocordyceps subramaniannii Hirsu2|1531
Ophiocordyceps subramaniannii Hirsu2|5152
Ophiocordyceps subramaniannii Hirsu2|5593

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6204
MDDIAVVGIGLRFPGEATSPGELWKVLERAESQWSEFPRDRLNIDGYFHPSGDRQGSISFRGAHFLKGDIAAFDS
PFFSIAAEDAKAIDPQQRMLLEVSYEALENAGLRKEDLDGSDTAVYVGSFVKDYEQICLRDPDWQPRYAATGNGI
AIMANRISHYFNFHGPSMTIDTGCSGSLVSVHLAAQSLRNGESSLAIAAGSGMILTPNTIMPMTALNFLSPDGKC
FTFDERANGYGRGEGIGVVVLKRLSDALRDNDTIRAVIRGSAVNQDGRTPGITLPSKEAQVANIRSVYANAGLDF
SQTAYVECHGTGTQAGDWRELKAISETLGSVRPIEKPIVVGSIKPNIGHLEGAAGVAGMIKGVLVLEHAQIPPNI
NFQRGNPAIDFQDWRVQVPQSAMQWPVKGVRRVSVNCFGFGGTNAHVILDEAPAYLSSRGLTGQHSSFDLTAETE
RLASSPTLESLPAVPRLFCYSSHEKSGVLRVVKSHVEYLNAAKQDFSAVYLRDYAYTLGCRRSNMEWKGFVVAGT
APELVSEAQSMSTNDAVRTSRDQRPRIGFIFCGQGSQWAQMGVDLMIYDVFRQSVEEASQYMAAVLHSPVDLMAE
ILRNGDESSISQPYISQPATTAIQVALVDLLSSFGIVPQHVVGHSSGEIAAAYAAGALSKQHAWAAAHSRGFAAS
SIRSIAPKLKGGMMVVGMSEKETEAYLEEACQSAQVACINSPRSITISGQAEAIAFIEKDLRGRGIFCRTLDVNV
AYHSSHMKLVEHGYRDSLANLAARKCSPSVSMFSSVTGEIVQGPELNASYWAANMVSPVRYVAAISSMMRLPADE
RPNCIIELSPRPSLRSPTIDILSDLAVNPQPNYHPILDPKANGAVSLLRLIGSLWSQGYSVDMETVLGQDSYPSP
PKCLSDLPPYPWNHSKSYWHESHLSLANRFREYGRQDLIGAPTADSVPFEPRWRGFLRVSENPWIQDHQVQKTMV
YPAAGMVSMVLEGARQMVRDAADGILGYEIANMQIEKAMIIPTSAHGLEVALNIKAGQDSVEAMEFCIYSKPLGR
EWERNAMGGLFFRTRHEGWATVFQSHDARHEALAKSCSESLNPRQLYEFLDTVGMNYGPLFQNITEVRKGANACV
AQVRVPDTKSKMPAKFEYPHLIHPATLDSMFQTLFAIDSSPMVPTFIKSIFVSANVSDPDPSPFVGYATAERTGI
RDADATIVMRRSSSSPARVIVEGLHLTGLSTPSPAEGGFLPNHRNLCTQIVWDQDATFATPTQYAEQVAILAHKY
PALDVLQVGGGLSAAIATLDVVAPNPAEAPRLARYTFVGRPDTEDAAEILSHVQGTPLEHFVEVKKDCSGLPTDY
HLIVTFSDASYDANELRTHLKPEGIFLSHSEPRNGGAEHCQTQILDQIAFSTDDGRSAIMDVFRNHTTVASSGAK
AHPVVLLLPDTPDAEASAFAEGLKQMENEGGWHLKVTSVSVGEIGNDAAPLAGQIVISLLDFAEGDAQGCSVYAW
EEADFAAFHLVQKVAKGIVWITRGAHMKPLNPKGAPIIALARTLMSEDPLKMIVTFDMGFESRLSSPSILRLVVA
VFEQAFHAKPGPGPRETEYAEEDGRLYIPRLTTIPSLNRLIEDDGQDADFTRRSFCPNPATPAPKTGLQLTIARP
GISSDSLYFSEFSQAELGPDEVEIWLEKAALTHLDLETVMGRTVESTIGMDVVGRVKRVGSSVGGIRPDDLVAAL
VSEGAIRNSVHAKAKLVVKNRPGVVPSLYVSAYYGIVHVGRARPDRTVLVQAGASAHGLAAVQIATAVGAEVFAT
VLGPDSARQRQVLLESGVAGDRIVDADSDSFVKAFRAASNGKGADVVYNPTRENVDASFGCVGKCGTIVQFADGA
ASPRPLPMTGGSVSIVSFDLRQLIRDDDELVVEMLERTGQLMESRVPALRLPPGAELATDMGDVEQALKQLQETR
RGR*
Coding >Hirsu2|6204
ATGGACGACATCGCTGTGGTGGGTATCGGCCTCCGCTTCCCTGGAGAAGCTACCTCACCCGGGGAGCTCTGGAAG
GTGCTTGAGCGCGCCGAGTCGCAATGGTCAGAGTTCCCCCGAGATCGTCTCAACATCGACGGGTACTTTCATCCG
AGTGGAGATCGCCAAGGCAGTATCTCTTTCCGTGGGGCCCATTTCCTCAAAGGGGACATCGCCGCGTTCGACTCG
CCTTTCTTCTCAATCGCAGCTGAAGATGCCAAGGCCATCGACCCTCAGCAGAGGATGCTGCTCGAGGTCTCCTAT
GAGGCTCTCGAAAACGCTGGACTCCGCAAGGAGGATCTCGACGGTAGCGATACGGCTGTCTACGTCGGCTCCTTC
GTCAAAGACTACGAGCAAATATGCCTTCGGGATCCCGACTGGCAGCCGCGCTATGCGGCCACCGGCAATGGCATT
GCCATCATGGCGAACCGTATTTCGCACTACTTCAACTTTCATGGCCCCAGCATGACCATCGACACCGGCTGCAGT
GGCAGCCTGGTGTCGGTCCACCTGGCCGCACAAAGCTTGCGGAATGGCGAATCATCTCTGGCCATCGCGGCCGGG
TCTGGCATGATCCTGACGCCCAACACCATCATGCCCATGACGGCGCTGAATTTCCTGAGTCCGGATGGCAAGTGC
TTCACATTCGACGAACGCGCGAATGGATACGGCCGCGGTGAGGGCATTGGCGTCGTCGTCTTGAAGCGGCTATCC
GACGCGCTGCGCGACAACGACACAATCCGGGCCGTCATCCGCGGCAGCGCCGTCAACCAGGACGGTCGGACTCCT
GGCATAACCCTCCCCAGCAAGGAGGCTCAAGTGGCAAACATCCGCTCCGTATATGCGAATGCAGGGCTCGATTTC
AGCCAAACGGCCTACGTAGAGTGTCATGGCACCGGAACGCAGGCAGGTGACTGGCGGGAACTCAAGGCAATCTCC
GAGACGCTCGGCTCCGTCAGGCCTATCGAGAAGCCCATCGTCGTCGGGTCCATCAAGCCCAACATCGGGCATCTC
GAGGGTGCAGCCGGTGTGGCGGGCATGATCAAAGGCGTCTTGGTTCTTGAGCACGCACAGATCCCTCCGAACATC
AACTTTCAGAGGGGAAACCCAGCGATTGACTTCCAGGACTGGAGGGTGCAGGTTCCTCAGTCTGCCATGCAGTGG
CCGGTTAAGGGTGTTCGTCGGGTGAGCGTCAATTGCTTCGGTTTCGGCGGCACGAATGCCCACGTTATCCTGGAC
GAAGCCCCTGCCTATCTCTCCAGTCGAGGCTTGACTGGCCAGCACAGCTCCTTCGACCTGACAGCTGAGACGGAG
CGGCTGGCTTCGTCCCCAACCCTTGAGTCGCTGCCGGCTGTCCCGCGGCTATTCTGCTACTCATCACACGAGAAG
AGCGGCGTGTTGCGAGTTGTCAAGTCGCACGTTGAATACCTGAACGCTGCTAAGCAAGACTTCTCGGCCGTCTAC
CTGCGAGACTACGCCTACACGCTCGGCTGTCGACGGTCCAACATGGAATGGAAGGGATTCGTCGTGGCCGGCACC
GCACCGGAACTTGTCTCCGAGGCCCAGAGCATGAGCACCAACGATGCGGTGCGAACTTCCCGGGATCAAAGGCCC
CGGATAGGCTTCATCTTCTGCGGCCAGGGCTCTCAGTGGGCACAGATGGGAGTGGACCTCATGATTTACGACGTC
TTCCGTCAAAGTGTCGAGGAAGCCAGCCAGTACATGGCGGCCGTGCTGCACTCCCCCGTCGACCTCATGGCAGAG
ATTCTAAGAAACGGGGACGAAAGCAGCATCTCGCAGCCTTACATATCGCAGCCCGCCACGACCGCGATTCAAGTC
GCCCTCGTGGACCTTCTCAGCTCATTTGGCATCGTGCCCCAACACGTCGTCGGCCATTCTTCCGGGGAGATCGCT
GCCGCCTATGCCGCTGGCGCTCTGTCGAAGCAACACGCTTGGGCGGCTGCTCACAGTCGAGGCTTCGCCGCTTCA
AGCATCCGTTCGATTGCTCCGAAGCTGAAAGGAGGCATGATGGTTGTCGGTATGTCTGAGAAAGAGACGGAGGCC
TACCTTGAGGAGGCCTGCCAATCAGCCCAAGTCGCTTGCATCAACAGCCCGCGATCCATCACCATCTCTGGCCAG
GCCGAGGCGATCGCGTTCATCGAGAAGGACTTGCGCGGGCGAGGCATTTTCTGCCGCACGCTCGACGTCAATGTT
GCCTACCACTCTTCTCACATGAAGCTCGTGGAGCACGGCTATCGGGACTCCCTCGCCAACCTCGCCGCACGCAAG
TGCTCGCCGTCCGTCAGCATGTTCTCGTCGGTCACCGGCGAAATCGTCCAAGGCCCGGAGCTGAATGCCTCCTAC
TGGGCGGCCAACATGGTGTCGCCGGTGCGCTACGTCGCGGCGATCAGTTCAATGATGCGGCTTCCGGCAGACGAG
AGGCCCAATTGTATCATCGAGCTCAGCCCTCGGCCGTCTCTGCGGTCCCCCACGATAGACATTCTGTCTGACCTG
GCCGTGAACCCACAGCCCAACTATCATCCGATACTCGACCCCAAGGCGAATGGCGCCGTATCTCTTCTCAGGCTG
ATAGGTAGCCTGTGGTCTCAGGGATATTCCGTCGACATGGAGACGGTTCTCGGGCAAGACTCCTATCCGTCTCCG
CCAAAGTGTCTGTCGGATCTTCCGCCTTATCCCTGGAACCATTCCAAGTCGTACTGGCACGAATCACATCTGAGC
CTGGCGAACCGCTTCCGGGAATATGGGCGACAGGATCTCATCGGCGCCCCCACTGCTGATTCGGTGCCGTTCGAG
CCCCGATGGCGCGGCTTTCTTCGAGTTTCGGAGAACCCTTGGATTCAAGATCATCAGGTACAGAAGACGATGGTC
TATCCGGCAGCCGGCATGGTGTCCATGGTGCTCGAGGGTGCCAGGCAAATGGTTCGCGACGCAGCTGACGGCATC
CTCGGCTACGAGATTGCCAACATGCAGATTGAGAAGGCAATGATCATACCGACTTCTGCTCACGGCCTCGAGGTC
GCCTTGAACATCAAGGCCGGCCAAGACTCTGTCGAGGCAATGGAATTCTGCATCTACTCGAAGCCTCTCGGCCGC
GAATGGGAGCGAAACGCCATGGGCGGCCTTTTCTTCAGAACGAGACACGAGGGCTGGGCCACCGTCTTCCAGTCT
CACGATGCCCGGCACGAGGCTCTGGCAAAGTCGTGTTCGGAGTCGTTGAACCCGCGCCAGCTGTACGAGTTCCTG
GACACGGTCGGCATGAACTACGGTCCTCTCTTCCAGAACATCACCGAGGTTCGCAAGGGCGCCAACGCTTGCGTC
GCCCAAGTCCGTGTGCCCGACACCAAGTCCAAGATGCCCGCCAAGTTCGAGTACCCTCACCTGATCCACCCGGCC
ACTCTTGATTCCATGTTCCAGACGCTCTTCGCCATTGACTCGTCGCCCATGGTGCCGACTTTCATCAAGAGCATC
TTTGTCTCGGCCAACGTGAGCGATCCTGACCCGTCTCCCTTCGTCGGCTACGCCACTGCCGAGCGCACGGGGATT
CGAGATGCGGATGCGACCATCGTCATGAGGCGGTCCAGTTCGTCGCCGGCCCGCGTCATCGTCGAGGGGCTTCAC
CTCACCGGCCTCTCGACGCCATCCCCTGCCGAAGGCGGCTTCTTGCCCAACCACCGTAACCTTTGCACTCAGATC
GTTTGGGACCAAGACGCCACCTTTGCCACGCCGACCCAATACGCAGAACAGGTCGCCATTCTCGCCCACAAGTAC
CCCGCGCTTGATGTTCTCCAGGTCGGCGGCGGCCTTTCGGCTGCCATTGCAACCCTCGACGTCGTGGCCCCGAAT
CCCGCCGAGGCACCGCGGCTGGCAAGGTACACGTTTGTCGGGCGGCCCGACACGGAAGACGCGGCCGAGATTCTG
TCTCACGTCCAGGGCACTCCGCTGGAGCACTTCGTGGAGGTCAAGAAGGACTGCTCCGGGCTTCCAACTGATTAT
CATCTCATCGTCACCTTTTCTGACGCAAGCTACGATGCAAACGAGTTGAGGACGCACCTGAAGCCTGAAGGCATA
TTCTTAAGCCACAGCGAGCCACGGAATGGCGGCGCGGAGCATTGTCAAACGCAGATTTTGGATCAGATTGCGTTT
AGCACCGATGATGGCCGCTCTGCGATCATGGACGTCTTCCGAAACCACACCACTGTCGCTTCTTCTGGAGCGAAG
GCCCATCCCGTTGTTCTTCTGCTACCCGATACACCTGACGCCGAGGCGTCGGCTTTTGCCGAGGGGTTGAAGCAA
ATGGAGAACGAAGGCGGGTGGCACCTCAAGGTGACTTCGGTTTCGGTCGGCGAGATCGGGAACGACGCAGCGCCA
CTTGCCGGACAAATTGTCATCTCGCTCCTCGACTTCGCCGAGGGCGACGCGCAGGGCTGCTCCGTCTATGCCTGG
GAGGAGGCCGACTTTGCGGCCTTCCACCTGGTGCAAAAGGTTGCCAAGGGCATCGTCTGGATTACTCGCGGCGCC
CACATGAAGCCTCTCAACCCAAAGGGCGCTCCCATCATTGCGCTCGCCAGGACGCTCATGTCAGAGGATCCGCTC
AAGATGATCGTCACCTTCGACATGGGCTTTGAATCGCGACTGAGCAGCCCGTCCATCCTTCGACTCGTCGTGGCA
GTGTTTGAGCAGGCCTTCCACGCAAAGCCCGGGCCCGGGCCGCGCGAGACCGAGTACGCGGAGGAAGACGGCAGG
CTCTACATCCCCCGCCTGACCACGATTCCATCCCTGAACAGGCTCATCGAGGACGACGGCCAAGACGCAGACTTC
ACCCGGAGGTCCTTCTGTCCGAACCCAGCCACACCGGCCCCCAAGACGGGCCTTCAGCTCACCATCGCGCGGCCA
GGCATCTCTAGCGACTCGCTCTACTTTTCTGAGTTCTCCCAGGCCGAGCTGGGGCCGGATGAGGTCGAGATCTGG
CTGGAGAAAGCAGCCTTGACGCATCTAGACCTCGAGACCGTCATGGGACGGACCGTCGAGTCCACCATCGGCATG
GACGTCGTCGGACGCGTGAAGCGAGTTGGGAGCAGCGTCGGCGGGATTCGGCCGGACGACTTGGTGGCCGCGCTG
GTGTCCGAGGGCGCGATACGAAACAGCGTGCACGCCAAAGCCAAGCTCGTGGTCAAGAACCGACCGGGAGTCGTG
CCCAGCCTCTACGTCAGCGCCTACTACGGGATCGTCCACGTCGGCCGAGCAAGACCCGACCGGACGGTCCTCGTC
CAGGCGGGAGCGAGCGCCCACGGGCTGGCAGCCGTTCAGATCGCGACGGCTGTCGGCGCCGAGGTGTTTGCGACG
GTGCTCGGGCCCGACTCGGCACGCCAGCGACAGGTGCTCCTCGAAAGCGGCGTGGCCGGCGACCGCATCGTCGAT
GCCGACTCGGACAGCTTCGTCAAGGCTTTCCGCGCGGCGAGCAACGGCAAAGGCGCCGACGTCGTCTACAACCCG
ACACGGGAGAACGTGGACGCGAGCTTCGGCTGCGTCGGAAAATGTGGAACGATCGTCCAGTTCGCGGACGGGGCG
GCCTCGCCTCGGCCGCTGCCCATGACGGGAGGCTCGGTGAGCATCGTCAGCTTCGACCTCCGCCAGCTGATTCGC
GACGACGACGAGCTCGTCGTCGAGATGCTGGAGCGCACCGGCCAGCTCATGGAGAGCCGAGTCCCGGCCCTTCGC
CTGCCCCCCGGCGCCGAGCTCGCCACGGACATGGGCGATGTCGAACAGGCCCTGAAGCAGCTGCAAGAGACGCGG
CGCGGCCGCTGA
Transcript >Hirsu2|6204
ATGGACGACATCGCTGTGGTGGGTATCGGCCTCCGCTTCCCTGGAGAAGCTACCTCACCCGGGGAGCTCTGGAAG
GTGCTTGAGCGCGCCGAGTCGCAATGGTCAGAGTTCCCCCGAGATCGTCTCAACATCGACGGGTACTTTCATCCG
AGTGGAGATCGCCAAGGCAGTATCTCTTTCCGTGGGGCCCATTTCCTCAAAGGGGACATCGCCGCGTTCGACTCG
CCTTTCTTCTCAATCGCAGCTGAAGATGCCAAGGCCATCGACCCTCAGCAGAGGATGCTGCTCGAGGTCTCCTAT
GAGGCTCTCGAAAACGCTGGACTCCGCAAGGAGGATCTCGACGGTAGCGATACGGCTGTCTACGTCGGCTCCTTC
GTCAAAGACTACGAGCAAATATGCCTTCGGGATCCCGACTGGCAGCCGCGCTATGCGGCCACCGGCAATGGCATT
GCCATCATGGCGAACCGTATTTCGCACTACTTCAACTTTCATGGCCCCAGCATGACCATCGACACCGGCTGCAGT
GGCAGCCTGGTGTCGGTCCACCTGGCCGCACAAAGCTTGCGGAATGGCGAATCATCTCTGGCCATCGCGGCCGGG
TCTGGCATGATCCTGACGCCCAACACCATCATGCCCATGACGGCGCTGAATTTCCTGAGTCCGGATGGCAAGTGC
TTCACATTCGACGAACGCGCGAATGGATACGGCCGCGGTGAGGGCATTGGCGTCGTCGTCTTGAAGCGGCTATCC
GACGCGCTGCGCGACAACGACACAATCCGGGCCGTCATCCGCGGCAGCGCCGTCAACCAGGACGGTCGGACTCCT
GGCATAACCCTCCCCAGCAAGGAGGCTCAAGTGGCAAACATCCGCTCCGTATATGCGAATGCAGGGCTCGATTTC
AGCCAAACGGCCTACGTAGAGTGTCATGGCACCGGAACGCAGGCAGGTGACTGGCGGGAACTCAAGGCAATCTCC
GAGACGCTCGGCTCCGTCAGGCCTATCGAGAAGCCCATCGTCGTCGGGTCCATCAAGCCCAACATCGGGCATCTC
GAGGGTGCAGCCGGTGTGGCGGGCATGATCAAAGGCGTCTTGGTTCTTGAGCACGCACAGATCCCTCCGAACATC
AACTTTCAGAGGGGAAACCCAGCGATTGACTTCCAGGACTGGAGGGTGCAGGTTCCTCAGTCTGCCATGCAGTGG
CCGGTTAAGGGTGTTCGTCGGGTGAGCGTCAATTGCTTCGGTTTCGGCGGCACGAATGCCCACGTTATCCTGGAC
GAAGCCCCTGCCTATCTCTCCAGTCGAGGCTTGACTGGCCAGCACAGCTCCTTCGACCTGACAGCTGAGACGGAG
CGGCTGGCTTCGTCCCCAACCCTTGAGTCGCTGCCGGCTGTCCCGCGGCTATTCTGCTACTCATCACACGAGAAG
AGCGGCGTGTTGCGAGTTGTCAAGTCGCACGTTGAATACCTGAACGCTGCTAAGCAAGACTTCTCGGCCGTCTAC
CTGCGAGACTACGCCTACACGCTCGGCTGTCGACGGTCCAACATGGAATGGAAGGGATTCGTCGTGGCCGGCACC
GCACCGGAACTTGTCTCCGAGGCCCAGAGCATGAGCACCAACGATGCGGTGCGAACTTCCCGGGATCAAAGGCCC
CGGATAGGCTTCATCTTCTGCGGCCAGGGCTCTCAGTGGGCACAGATGGGAGTGGACCTCATGATTTACGACGTC
TTCCGTCAAAGTGTCGAGGAAGCCAGCCAGTACATGGCGGCCGTGCTGCACTCCCCCGTCGACCTCATGGCAGAG
ATTCTAAGAAACGGGGACGAAAGCAGCATCTCGCAGCCTTACATATCGCAGCCCGCCACGACCGCGATTCAAGTC
GCCCTCGTGGACCTTCTCAGCTCATTTGGCATCGTGCCCCAACACGTCGTCGGCCATTCTTCCGGGGAGATCGCT
GCCGCCTATGCCGCTGGCGCTCTGTCGAAGCAACACGCTTGGGCGGCTGCTCACAGTCGAGGCTTCGCCGCTTCA
AGCATCCGTTCGATTGCTCCGAAGCTGAAAGGAGGCATGATGGTTGTCGGTATGTCTGAGAAAGAGACGGAGGCC
TACCTTGAGGAGGCCTGCCAATCAGCCCAAGTCGCTTGCATCAACAGCCCGCGATCCATCACCATCTCTGGCCAG
GCCGAGGCGATCGCGTTCATCGAGAAGGACTTGCGCGGGCGAGGCATTTTCTGCCGCACGCTCGACGTCAATGTT
GCCTACCACTCTTCTCACATGAAGCTCGTGGAGCACGGCTATCGGGACTCCCTCGCCAACCTCGCCGCACGCAAG
TGCTCGCCGTCCGTCAGCATGTTCTCGTCGGTCACCGGCGAAATCGTCCAAGGCCCGGAGCTGAATGCCTCCTAC
TGGGCGGCCAACATGGTGTCGCCGGTGCGCTACGTCGCGGCGATCAGTTCAATGATGCGGCTTCCGGCAGACGAG
AGGCCCAATTGTATCATCGAGCTCAGCCCTCGGCCGTCTCTGCGGTCCCCCACGATAGACATTCTGTCTGACCTG
GCCGTGAACCCACAGCCCAACTATCATCCGATACTCGACCCCAAGGCGAATGGCGCCGTATCTCTTCTCAGGCTG
ATAGGTAGCCTGTGGTCTCAGGGATATTCCGTCGACATGGAGACGGTTCTCGGGCAAGACTCCTATCCGTCTCCG
CCAAAGTGTCTGTCGGATCTTCCGCCTTATCCCTGGAACCATTCCAAGTCGTACTGGCACGAATCACATCTGAGC
CTGGCGAACCGCTTCCGGGAATATGGGCGACAGGATCTCATCGGCGCCCCCACTGCTGATTCGGTGCCGTTCGAG
CCCCGATGGCGCGGCTTTCTTCGAGTTTCGGAGAACCCTTGGATTCAAGATCATCAGGTACAGAAGACGATGGTC
TATCCGGCAGCCGGCATGGTGTCCATGGTGCTCGAGGGTGCCAGGCAAATGGTTCGCGACGCAGCTGACGGCATC
CTCGGCTACGAGATTGCCAACATGCAGATTGAGAAGGCAATGATCATACCGACTTCTGCTCACGGCCTCGAGGTC
GCCTTGAACATCAAGGCCGGCCAAGACTCTGTCGAGGCAATGGAATTCTGCATCTACTCGAAGCCTCTCGGCCGC
GAATGGGAGCGAAACGCCATGGGCGGCCTTTTCTTCAGAACGAGACACGAGGGCTGGGCCACCGTCTTCCAGTCT
CACGATGCCCGGCACGAGGCTCTGGCAAAGTCGTGTTCGGAGTCGTTGAACCCGCGCCAGCTGTACGAGTTCCTG
GACACGGTCGGCATGAACTACGGTCCTCTCTTCCAGAACATCACCGAGGTTCGCAAGGGCGCCAACGCTTGCGTC
GCCCAAGTCCGTGTGCCCGACACCAAGTCCAAGATGCCCGCCAAGTTCGAGTACCCTCACCTGATCCACCCGGCC
ACTCTTGATTCCATGTTCCAGACGCTCTTCGCCATTGACTCGTCGCCCATGGTGCCGACTTTCATCAAGAGCATC
TTTGTCTCGGCCAACGTGAGCGATCCTGACCCGTCTCCCTTCGTCGGCTACGCCACTGCCGAGCGCACGGGGATT
CGAGATGCGGATGCGACCATCGTCATGAGGCGGTCCAGTTCGTCGCCGGCCCGCGTCATCGTCGAGGGGCTTCAC
CTCACCGGCCTCTCGACGCCATCCCCTGCCGAAGGCGGCTTCTTGCCCAACCACCGTAACCTTTGCACTCAGATC
GTTTGGGACCAAGACGCCACCTTTGCCACGCCGACCCAATACGCAGAACAGGTCGCCATTCTCGCCCACAAGTAC
CCCGCGCTTGATGTTCTCCAGGTCGGCGGCGGCCTTTCGGCTGCCATTGCAACCCTCGACGTCGTGGCCCCGAAT
CCCGCCGAGGCACCGCGGCTGGCAAGGTACACGTTTGTCGGGCGGCCCGACACGGAAGACGCGGCCGAGATTCTG
TCTCACGTCCAGGGCACTCCGCTGGAGCACTTCGTGGAGGTCAAGAAGGACTGCTCCGGGCTTCCAACTGATTAT
CATCTCATCGTCACCTTTTCTGACGCAAGCTACGATGCAAACGAGTTGAGGACGCACCTGAAGCCTGAAGGCATA
TTCTTAAGCCACAGCGAGCCACGGAATGGCGGCGCGGAGCATTGTCAAACGCAGATTTTGGATCAGATTGCGTTT
AGCACCGATGATGGCCGCTCTGCGATCATGGACGTCTTCCGAAACCACACCACTGTCGCTTCTTCTGGAGCGAAG
GCCCATCCCGTTGTTCTTCTGCTACCCGATACACCTGACGCCGAGGCGTCGGCTTTTGCCGAGGGGTTGAAGCAA
ATGGAGAACGAAGGCGGGTGGCACCTCAAGGTGACTTCGGTTTCGGTCGGCGAGATCGGGAACGACGCAGCGCCA
CTTGCCGGACAAATTGTCATCTCGCTCCTCGACTTCGCCGAGGGCGACGCGCAGGGCTGCTCCGTCTATGCCTGG
GAGGAGGCCGACTTTGCGGCCTTCCACCTGGTGCAAAAGGTTGCCAAGGGCATCGTCTGGATTACTCGCGGCGCC
CACATGAAGCCTCTCAACCCAAAGGGCGCTCCCATCATTGCGCTCGCCAGGACGCTCATGTCAGAGGATCCGCTC
AAGATGATCGTCACCTTCGACATGGGCTTTGAATCGCGACTGAGCAGCCCGTCCATCCTTCGACTCGTCGTGGCA
GTGTTTGAGCAGGCCTTCCACGCAAAGCCCGGGCCCGGGCCGCGCGAGACCGAGTACGCGGAGGAAGACGGCAGG
CTCTACATCCCCCGCCTGACCACGATTCCATCCCTGAACAGGCTCATCGAGGACGACGGCCAAGACGCAGACTTC
ACCCGGAGGTCCTTCTGTCCGAACCCAGCCACACCGGCCCCCAAGACGGGCCTTCAGCTCACCATCGCGCGGCCA
GGCATCTCTAGCGACTCGCTCTACTTTTCTGAGTTCTCCCAGGCCGAGCTGGGGCCGGATGAGGTCGAGATCTGG
CTGGAGAAAGCAGCCTTGACGCATCTAGACCTCGAGACCGTCATGGGACGGACCGTCGAGTCCACCATCGGCATG
GACGTCGTCGGACGCGTGAAGCGAGTTGGGAGCAGCGTCGGCGGGATTCGGCCGGACGACTTGGTGGCCGCGCTG
GTGTCCGAGGGCGCGATACGAAACAGCGTGCACGCCAAAGCCAAGCTCGTGGTCAAGAACCGACCGGGAGTCGTG
CCCAGCCTCTACGTCAGCGCCTACTACGGGATCGTCCACGTCGGCCGAGCAAGACCCGACCGGACGGTCCTCGTC
CAGGCGGGAGCGAGCGCCCACGGGCTGGCAGCCGTTCAGATCGCGACGGCTGTCGGCGCCGAGGTGTTTGCGACG
GTGCTCGGGCCCGACTCGGCACGCCAGCGACAGGTGCTCCTCGAAAGCGGCGTGGCCGGCGACCGCATCGTCGAT
GCCGACTCGGACAGCTTCGTCAAGGCTTTCCGCGCGGCGAGCAACGGCAAAGGCGCCGACGTCGTCTACAACCCG
ACACGGGAGAACGTGGACGCGAGCTTCGGCTGCGTCGGAAAATGTGGAACGATCGTCCAGTTCGCGGACGGGGCG
GCCTCGCCTCGGCCGCTGCCCATGACGGGAGGCTCGGTGAGCATCGTCAGCTTCGACCTCCGCCAGCTGATTCGC
GACGACGACGAGCTCGTCGTCGAGATGCTGGAGCGCACCGGCCAGCTCATGGAGAGCCGAGTCCCGGCCCTTCGC
CTGCCCCCCGGCGCCGAGCTCGCCACGGACATGGGCGATGTCGAACAGGCCCTGAAGCAGCTGCAAGAGACGCGG
CGCGGCCGCTGA
Gene >Hirsu2|6204
ATGGACGACATCGCTGTGGTGGGTATCGGCCTCCGCTTCCCTGGAGAAGCTACCTCACCCGGGGAGCTCTGGAAG
GTGCTTGAGCGCGCCGAGTCGCAATGGTCAGAGTTCCCCCGAGATCGTCTCAACATCGACGGGTACTTTCATCCG
AGTGGAGATCGCCAAGGCAGTGTGAGTCCCAAGGTTACACCATCACTCAGTCAAAATGGAATCTAACGATTTAGA
TCTCTTTCCGTGGGGCCCATTTCCTCAAAGGGGACATCGCCGCGTTCGACTCGCCTGTGAGCAACTCTATTCGGT
CCCCCTCTTCACGTTCCTCGGGCCGCTGAAATCTTATCCCTGCATAAGTTCTTCTCAATCGCAGCTGAAGATGCC
AAGGCCATCGACCCTCAGCAGAGGATGCTGCTCGAGGTCTCCTATGAGGCTCTCGAAAACGGTACGACTCCCTGC
TTAGAGTACGGCCGATGCTTTGGGCCACTGGGGCTGACCCGTCCTCCGTTTAGCTGGACTCCGCAAGGAGGATCT
CGACGGTAGCGATACGGCTGTCTACGTCGGCTCCTTCGTCAAAGGTATGCGCTGCCTAGTCCTGGACTCTGCGCC
TCGCCCCGAAGCCAAACTCCCCTTACCCACTCCCTTCTGCCCCTTGGCAGCTGAGCTCACACGTTCCAGACTACG
AGCAAATATGCCTTCGGGATCCCGACTGGCAGCCGCGCTATGCGGCCACCGGCAATGGCATTGCCATCATGGCGA
ACCGTATTTCGCACTACTTCAACTTTCATGGCCCCAGCATGACCATCGACACCGGCTGCAGTGGCAGCCTGGTGT
CGGTCCACCTGGCCGCACAAAGCTTGCGGAATGGCGAATCATCTCTGGTAGGAACGACTGCTAGACGGAATGGTG
TTGACGAAGAGAATCCTTTGCTGACGTCAATCAGGCCATCGCGGCCGGGTCTGGCATGATCCTGACGCCCAACAC
CATCATGCCCATGACGGCGCTGAATTTCCTGAGTCCGGATGGCAAGTGCTTCACATTCGACGAACGCGCGAATGG
ATACGGCCGCGGTGAGGGCATTGGCGTCGTCGTCTTGAAGCGGCTATCCGACGCGCTGCGCGACAACGACACAAT
CCGGGCCGTCATCCGCGGCAGCGCCGTCAACCAGGACGGTCGGACTCCTGGTTCGTCTTTCCCGCCCGGCCAACA
TCCTCCCACCTCTTCTGACACTGTACTTGTACTCAGGCATAACCCTCCCCAGCAAGGAGGCTCAAGTGGCAAACA
TCCGCTCCGTATATGCGAATGCAGGGCTCGATTTCAGCCAAACGGCCTACGTAGAGTGTCATGGCACCGGAACGC
AGGCAGGTGACTGGCGGGAACTCAAGGCAATCTCCGAGACGCTCGGCTCCGTCAGGCCTATCGAGAAGCCCATCG
TCGTCGGGTCCATCAAGCCCAACATCGGGCATCTCGAGGGTGCAGCCGGTGTGGCGGGCATGATCAAAGGCGTCT
TGGTTCTTGAGCACGCACAGATCCCTCCGAACATCAACTTTCAGAGGGGAAACCCAGCGATTGACTTCCAGGACT
GGAGGGTGCAGGTGAGCGCCTACCGGCATAAGTCTTCTCCTTGCCCATTCATGGTGCTAAGAGGTGACGTCCAGG
TTCCTCAGTCTGCCATGCAGTGGCCGGTTAAGGGTGTTCGTCGGGTGAGCGTCAATTGCTTCGGTTTCGGCGGCA
CGAATGCCCACGTTATCCTGGACGAAGCCCCTGCCTATCTCTCCAGTCGAGGCTTGACTGGCCAGCACAGCTCCT
TCGACCTGACAGCTGAGACGGAGCGGCTGGCTTCGTCCCCAACCCTTGAGTCGCTGCCGGCTGTCCCGCGGCTAT
TCTGCTACTCATCACACGAGAAGAGCGGCGTGTTGCGAGTTGTCAAGTCGCACGTTGAATACCTGAACGCTGCTA
AGCAAGACTTCTCGGCCGTCTACCTGCGAGACTACGCCTACACGCTCGGCTGTCGACGGTCCAACATGGAATGGA
AGGGATTCGTCGTGGCCGGCACCGCACCGGAACTTGTCTCCGAGGCCCAGAGCATGAGCACCAACGATGCGGTGC
GAACTTCCCGGGATCAAAGGCCCCGGATAGGCTTCATCTTCTGCGGCCAGGGCTCTCAGTGGGCACAGATGGGAG
TGGACCTCATGATTTACGACGTCTTCCGTCAAAGTGTCGAGGAAGCCAGCCAGTACATGGCGGCCGTGCTGCACT
CCCCCGTCGACCTCATGGCAGAGATTCTAAGAAACGGGGACGAAAGCAGCATCTCGCAGCCTTACATATCGCAGC
CCGCCACGACCGCGATTCAAGTCGCCCTCGTGGACCTTCTCAGCTCATTTGGCATCGTGCCCCAACACGTCGTCG
GCCATTCTTCCGGGGAGATCGCTGCCGCCTATGCCGCTGGCGCTCTGTCGAAGCAACACGCTTGGGCGGCTGCTC
ACAGTCGAGGCTTCGCCGCTTCAAGCATCCGTTCGATTGCTCCGAAGCTGAAAGGAGGCATGATGGTTGTCGGTA
TGTCTGAGAAAGAGACGGAGGCCTACCTTGAGGAGGCCTGCCAATCAGCCCAAGTCGCTTGCATCAACAGCCCGC
GATCCATCACCATCTCTGGCCAGGCCGAGGCGATCGCGTTCATCGAGAAGGACTTGCGCGGGCGAGGCATTTTCT
GCCGCACGCTCGACGTCAATGTTGCCTACCACTCTTCTCACATGAAGCTCGTGGAGCACGGCTATCGGGACTCCC
TCGCCAACCTCGCCGCACGCAAGTGCTCGCCGTCCGTCAGCATGTTCTCGTCGGTCACCGGCGAAATCGTCCAAG
GCCCGGAGCTGAATGCCTCCTACTGGGCGGCCAACATGGTGTCGCCGGTGCGCTACGTCGCGGCGATCAGTTCAA
TGATGCGGCTTCCGGCAGACGAGAGGCCCAATTGTATCATCGAGCTCAGCCCTCGGCCGTCTCTGCGGTCCCCCA
CGATAGACATTCTGTCTGACCTGGCCGTGAACCCACAGCCCAACTATCATCCGATACTCGACCCCAAGGCGAATG
GCGCCGTATCTCTTCTCAGGCTGATAGGTAGCCTGTGGTCTCAGGGATATTCCGTCGACATGGAGACGGTTCTCG
GGCAAGACTCCTATCCGTCTCCGCCAAAGTGTCTGTCGGATCTTCCGCCTTATCCCTGGAACCATTCCAAGTCGT
ACTGGCACGAATCACATCTGAGCCTGGCGAACCGCTTCCGGGAATATGGGCGACAGGATCTCATCGGCGCCCCCA
CTGCTGATTCGGTGCCGTTCGAGCCCCGATGGCGCGGCTTTCTTCGAGTTTCGGAGAACCCTTGGATTCAAGATC
ATCAGGTACAGAAGACGATGGTCTATCCGGCAGCCGGCATGGTGTCCATGGTGCTCGAGGGTGCCAGGCAAATGG
TTCGCGACGCAGCTGACGGCATCCTCGGCTACGAGATTGCCAACATGCAGATTGAGAAGGCAATGATCATACCGA
CTTCTGCTCACGGCCTCGAGGTCGCCTTGAACATCAAGGCCGGCCAAGACTCTGTCGAGGCAATGGAATTCTGCA
TCTACTCGAAGCCTCTCGGCCGCGAATGGGAGCGAAACGCCATGGGCGGCCTTTTCTTCAGAACGAGACACGAGG
GCTGGGCCACCGTCTTCCAGTCTCACGATGCCCGGCACGAGGCTCTGGCAAAGTCGTGTTCGGAGTCGTTGAACC
CGCGCCAGCTGTACGAGTTCCTGGACACGGTCGGCATGAACTACGGTCCTCTCTTCCAGAACATCACCGAGGTTC
GCAAGGGCGCCAACGCTTGCGTCGCCCAAGTCCGTGTGCCCGACACCAAGTCCAAGATGCCCGCCAAGTTCGAGT
ACCCTCACCTGATCCACCCGGCCACTCTTGATTCCATGTTCCAGACGCTCTTCGCCATTGACTCGTCGCCCATGG
TGCCGACTTTCATCAAGAGCATCTTTGTCTCGGCCAACGTGAGCGATCCTGACCCGTCTCCCTTCGTCGGCTACG
CCACTGCCGAGCGCACGGGGATTCGAGATGCGGATGCGACCATCGTCATGAGGCGGTCCAGTTCGTCGCCGGCCC
GCGTCATCGTCGAGGGGCTTCACCTCACCGGCCTCTCGACGCCATCCCCTGCCGAAGGCGGCTTCTTGCCCAACC
ACCGTAACCTTTGCACTCAGATCGTTTGGGACCAAGACGCCACCTTTGCCACGCCGACCCAATACGCAGAACAGG
TCGCCATTCTCGCCCACAAGTACCCCGCGCTTGATGTTCTCCAGGTCGGCGGCGGCCTTTCGGCTGCCATTGCAA
CCCTCGACGTCGTGGCCCCGAATCCCGCCGAGGCACCGCGGCTGGCAAGGTACACGTTTGTCGGGCGGCCCGACA
CGGAAGACGCGGCCGAGATTCTGTCTCACGTCCAGGGCACTCCGCTGGAGCACTTCGTGGAGGTCAAGAAGGACT
GCTCCGGGCTTCCAACTGATTATCATCTCATCGTCACCTTTTCTGACGCAAGCTACGATGCAAACGAGTTGAGGA
CGCACCTGAAGCCTGAAGGCATATTCTTAAGCCACAGCGAGCCACGGAATGGCGGCGCGGAGCATTGTCAAACGC
AGATTTTGGATCAGATTGCGTTTAGCACCGATGATGGCCGCTCTGCGATCATGGACGTCTTCCGAAACCACACCA
CTGTCGCTTCTTCTGGAGCGAAGGCCCATCCCGTTGTTCTTCTGCTACCCGATACACCTGACGCCGAGGCGTCGG
CTTTTGCCGAGGGGTTGAAGCAAATGGAGAACGAAGGCGGGTGGCACCTCAAGGTGACTTCGGTTTCGGTCGGCG
AGATCGGGAACGACGCAGCGCCACTTGCCGGACAAATTGTCATCTCGCTCCTCGACTTCGCCGAGGGCGACGCGC
AGGGCTGCTCCGTCTATGCCTGGGAGGAGGCCGACTTTGCGGCCTTCCACCTGGTGCAAAAGGTTGCCAAGGGCA
TCGTCTGGATTACTCGCGGCGCCCACATGAAGCCTCTCAACCCAAAGGGCGCTCCCATCATTGCGCTCGCCAGGA
CGCTCATGTCAGAGGATCCGCTCAAGATGATCGTCACCTTCGACATGGGCTTTGAATCGCGACTGAGCAGCCCGT
CCATCCTTCGACTCGTCGTGGCAGTGTTTGAGCAGGCCTTCCACGCAAAGCCCGGGCCCGGGCCGCGCGAGACCG
AGTACGCGGAGGAAGACGGCAGGCTCTACATCCCCCGCCTGACCACGATTCCATCCCTGAACAGGCTCATCGAGG
ACGACGGCCAAGACGCAGACTTCACCCGGAGGTCCTTCTGTCCGAACCCAGCCACACCGGCCCCCAAGACGGGCC
TTCAGCTCACCATCGCGCGGCCAGGCATCTCTAGCGACTCGCTCTACTTTTCTGAGTTCTCCCAGGCCGAGCTGG
GGCCGGATGAGGTCGAGATCTGGCTGGAGAAAGCAGCCTTGACGCATCTAGACCTCGAGACCGTCATGGGACGGA
CCGTCGAGTCCACCATCGGCATGGACGTCGTCGGACGCGTGAAGCGAGTTGGGAGCAGCGTCGGCGGGATTCGGC
CGGACGACTTGGTGGCCGCGCTGGTGTCCGAGGGCGCGATACGAAACAGCGTGCACGCCAAAGCCAAGCTCGTGG
TCAAGAACCGACCGGGAGTCGTGCCCAGCCTCTACGTCAGCGCCTACTACGGGATCGTCCACGTCGGCCGAGCAA
GACCCGACCGGACGGTCCTCGTCCAGGCGGGAGCGAGCGCCCACGGGCTGGCAGCCGTTCAGATCGCGACGGCTG
TCGGCGCCGAGGTGTTTGCGACGGTGCTCGGGCCCGACTCGGCACGCCAGCGACAGGTGCTCCTCGAAAGCGGCG
TGGCCGGCGACCGCATCGTCGATGCCGACTCGGACAGCTTCGTCAAGGCTTTCCGCGCGGCGAGCAACGGCAAAG
GCGCCGACGTCGTCTACAACCCGACACGGGAGAACGTGGACGCGAGCTTCGGCTGCGTCGGAAAATGCAAGTCCT
TGGCCTCCCCTTCTTCCCCTCTCACCACAAGCCGTCGGCGTGTGCTCTCATTGCTGACCTTGCAGCAGGTGGAAC
GATCGTCCAGTTCGCGGACGGGGCGGCCTCGCCTCGGCCGCTGCCCATGACGGGAGGCTCGGTGAGCATCGTCAG
CTTCGACCTCCGCCAGCTGATTCGCGACGACGACGAGCTCGTCGTCGAGATGCTGGAGCGCACCGGCCAGCTCAT
GGAGAGCCGAGTCCCGGCCCTTCGCCTGCCCCCCGGCGCCGAGCTCGCCACGGACATGGGCGATGTCGAACAGGC
CCTGAAGCAGCTGCAAGAGAGTCCGCACGTCGGGCTCGCGTGCCTGAGGGCGGGCGGCGAGCGCAAGGTCCGGGT
CGCCAACCGGAGCGCGGCGCGGCCGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail