Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6202
Gene name
LocationContig_3156:92..1043
Strand-
Gene length (bp)951
Transcript length (bp)894
Coding sequence length (bp)894
Protein length (aa) 298

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 9.1E-54 25 270
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 2.2E-12 30 278
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 2.9E-10 30 123

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 13 286 2.0E-36
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 18 287 3.0E-29
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 15 270 3.0E-25
sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 15 290 7.0E-24
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 15 270 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94305|MGLL_SCHPO Putative monoglyceride lipase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC5E4.05c PE=1 SV=1 13 286 2.0E-36
sp|Q55EQ3|Y9086_DICDI Uncharacterized abhydrolase domain-containing protein DDB_G0269086 OS=Dictyostelium discoideum GN=DDB_G0269086 PE=1 SV=2 18 287 3.0E-29
sp|Q8R431|MGLL_RAT Monoglyceride lipase OS=Rattus norvegicus GN=Mgll PE=1 SV=1 15 270 3.0E-25
sp|O35678|MGLL_MOUSE Monoglyceride lipase OS=Mus musculus GN=Mgll PE=1 SV=1 15 290 7.0E-24
sp|Q99685|MGLL_HUMAN Monoglyceride lipase OS=Homo sapiens GN=MGLL PE=1 SV=2 15 270 3.0E-22
sp|P28321|MGLL_YEAST Monoglyceride lipase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJU3 PE=1 SV=2 13 269 3.0E-16
sp|O34705|PLBAC_BACSU Phospholipase YtpA OS=Bacillus subtilis (strain 168) GN=ytpA PE=1 SV=1 19 267 5.0E-08
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5592 0.2358 0.2855 0.0476 0.4952 0.0197 0.3561 0.3208 0.2218 0.3391

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5455
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7910
Ophiocordyceps australis map64 (Brazil) OphauB2|4253
Ophiocordyceps camponoti-floridani Ophcf2|06094
Ophiocordyceps camponoti-rufipedis Ophun1|3879
Ophiocordyceps kimflemingae Ophio5|222
Ophiocordyceps subramaniannii Hirsu2|6202 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6202
MSVREGIFQHGNGNMYTKTWTPNGQVRAKLIFVHGFNEHINRYNDFFPKLTAHGIQVYGWDQRGWGRSVTKACER
GLTGPTQQVVADVAAFVRDKLPSPVPVFVMGHSMGGGEILTMAGDAQHSSLTGQMRGWILECPLIGFPAGQEPNT
VKVLAGRLVSRLLPRQQLHIVVPPEHLSRDAAVVESVRKDPLCHNTGTLEGLASLLDRTEALSSGQIRLSERVRS
ILLAHGTQDVICSQAAAIKFMESQQDVRDKTIRTYDGAYHQLHADNCKDEFARHLVDWILERCVAPQPEAKL*
Coding >Hirsu2|6202
ATGAGCGTTCGGGAAGGTATATTTCAGCACGGCAATGGCAACATGTACACGAAGACTTGGACTCCCAATGGACAG
GTCCGAGCGAAGCTCATTTTCGTACACGGATTCAACGAGCACATCAACCGTTATAACGATTTCTTCCCGAAATTG
ACTGCCCATGGCATACAGGTCTATGGTTGGGACCAACGGGGGTGGGGTCGCAGCGTGACCAAGGCGTGCGAAAGA
GGTCTGACGGGGCCGACGCAGCAAGTTGTGGCCGACGTGGCGGCCTTCGTCCGCGACAAGCTCCCATCGCCAGTT
CCAGTCTTTGTCATGGGACACTCAATGGGCGGTGGCGAGATTCTGACAATGGCTGGGGACGCGCAGCATTCTAGT
CTAACTGGCCAGATGCGTGGCTGGATCCTCGAGTGCCCCTTGATTGGCTTCCCAGCCGGCCAGGAACCCAACACC
GTCAAGGTTTTGGCCGGTCGTCTCGTAAGCAGACTGTTACCCCGGCAGCAACTTCATATCGTCGTTCCGCCCGAG
CATCTAAGCAGAGATGCTGCTGTTGTCGAATCGGTGCGTAAGGATCCGTTGTGTCATAACACAGGCACGCTCGAA
GGGCTCGCCTCACTGCTCGATCGCACTGAAGCTCTCTCGTCCGGTCAGATCCGGCTCAGTGAGCGGGTACGTAGC
ATCCTGCTTGCGCACGGGACACAGGACGTTATATGTAGTCAAGCCGCGGCCATCAAGTTTATGGAGAGTCAACAA
GACGTCCGGGACAAGACGATAAGAACGTACGACGGGGCATATCACCAGCTCCATGCAGATAACTGCAAAGATGAG
TTTGCTCGGCACCTAGTGGACTGGATACTAGAGCGATGTGTGGCACCGCAGCCGGAAGCGAAGTTGTGA
Transcript >Hirsu2|6202
ATGAGCGTTCGGGAAGGTATATTTCAGCACGGCAATGGCAACATGTACACGAAGACTTGGACTCCCAATGGACAG
GTCCGAGCGAAGCTCATTTTCGTACACGGATTCAACGAGCACATCAACCGTTATAACGATTTCTTCCCGAAATTG
ACTGCCCATGGCATACAGGTCTATGGTTGGGACCAACGGGGGTGGGGTCGCAGCGTGACCAAGGCGTGCGAAAGA
GGTCTGACGGGGCCGACGCAGCAAGTTGTGGCCGACGTGGCGGCCTTCGTCCGCGACAAGCTCCCATCGCCAGTT
CCAGTCTTTGTCATGGGACACTCAATGGGCGGTGGCGAGATTCTGACAATGGCTGGGGACGCGCAGCATTCTAGT
CTAACTGGCCAGATGCGTGGCTGGATCCTCGAGTGCCCCTTGATTGGCTTCCCAGCCGGCCAGGAACCCAACACC
GTCAAGGTTTTGGCCGGTCGTCTCGTAAGCAGACTGTTACCCCGGCAGCAACTTCATATCGTCGTTCCGCCCGAG
CATCTAAGCAGAGATGCTGCTGTTGTCGAATCGGTGCGTAAGGATCCGTTGTGTCATAACACAGGCACGCTCGAA
GGGCTCGCCTCACTGCTCGATCGCACTGAAGCTCTCTCGTCCGGTCAGATCCGGCTCAGTGAGCGGGTACGTAGC
ATCCTGCTTGCGCACGGGACACAGGACGTTATATGTAGTCAAGCCGCGGCCATCAAGTTTATGGAGAGTCAACAA
GACGTCCGGGACAAGACGATAAGAACGTACGACGGGGCATATCACCAGCTCCATGCAGATAACTGCAAAGATGAG
TTTGCTCGGCACCTAGTGGACTGGATACTAGAGCGATGTGTGGCACCGCAGCCGGAAGCGAAGTTGTGA
Gene >Hirsu2|6202
ATGAGCGTTCGGGAAGGTATATTTCAGCACGGCAATGGCAACATGTACACGAAGACTTGGACTGTAAGTCGTGAT
TGCCGGCTGGCTGAAACCGCGCTGATTGTCCGGCCCCACACAAAGCCCAATGGACAGGTCCGAGCGAAGCTCATT
TTCGTACACGGATTCAACGAGCACATCAACCGTTATAACGATTTCTTCCCGAAATTGACTGCCCATGGCATACAG
GTCTATGGTTGGGACCAACGGGGGTGGGGTCGCAGCGTGACCAAGGCGTGCGAAAGAGGTCTGACGGGGCCGACG
CAGCAAGTTGTGGCCGACGTGGCGGCCTTCGTCCGCGACAAGCTCCCATCGCCAGTTCCAGTCTTTGTCATGGGA
CACTCAATGGGCGGTGGCGAGATTCTGACAATGGCTGGGGACGCGCAGCATTCTAGTCTAACTGGCCAGATGCGT
GGCTGGATCCTCGAGTGCCCCTTGATTGGCTTCCCAGCCGGCCAGGAACCCAACACCGTCAAGGTTTTGGCCGGT
CGTCTCGTAAGCAGACTGTTACCCCGGCAGCAACTTCATATCGTCGTTCCGCCCGAGCATCTAAGCAGAGATGCT
GCTGTTGTCGAATCGGTGCGTAAGGATCCGTTGTGTCATAACACAGGCACGCTCGAAGGGCTCGCCTCACTGCTC
GATCGCACTGAAGCTCTCTCGTCCGGTCAGATCCGGCTCAGTGAGCGGGTACGTAGCATCCTGCTTGCGCACGGG
ACACAGGACGTTATATGTAGTCAAGCCGCGGCCATCAAGTTTATGGAGAGTCAACAAGACGTCCGGGACAAGACG
ATAAGAACGTACGACGGGGCATATCACCAGCTCCATGCAGATAACTGCAAAGATGAGTTTGCTCGGCACCTAGTG
GACTGGATACTAGAGCGATGTGTGGCACCGCAGCCGGAAGCGAAGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail