Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6190
Gene name
LocationContig_315:2273..2772
Strand+
Gene length (bp)499
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11764 N-SET COMPASS (Complex proteins associated with Set1p) component N 2.7E-44 4 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I5R3|SET1_GIBZE Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET1 PE=3 SV=2 1 147 2.0E-75
sp|Q2GWF3|SET1_CHAGB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET1 PE=3 SV=1 4 147 5.0E-71
sp|Q8X0S9|SET1_NEUCR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-1 PE=3 SV=1 1 147 2.0E-68
sp|Q2UMH3|SET1_ASPOR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set1 PE=3 SV=1 7 147 2.0E-49
sp|Q5B0Y5|SET1_EMENI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set1 PE=3 SV=1 3 147 2.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4I5R3|SET1_GIBZE Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SET1 PE=3 SV=2 1 147 2.0E-75
sp|Q2GWF3|SET1_CHAGB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SET1 PE=3 SV=1 4 147 5.0E-71
sp|Q8X0S9|SET1_NEUCR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=set-1 PE=3 SV=1 1 147 2.0E-68
sp|Q2UMH3|SET1_ASPOR Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=set1 PE=3 SV=1 7 147 2.0E-49
sp|Q5B0Y5|SET1_EMENI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=set1 PE=3 SV=1 3 147 2.0E-49
sp|Q1DR06|SET1_COCIM Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Coccidioides immitis (strain RS) GN=SET1 PE=3 SV=1 7 147 6.0E-47
sp|Q4WNH8|SET1_ASPFU Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=set1 PE=3 SV=1 3 147 1.0E-46
sp|Q6CEK8|SET1_YARLI Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SET1 PE=3 SV=1 14 147 3.0E-29
sp|Q6BKL7|SET1_DEBHA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SET1 PE=3 SV=2 16 147 4.0E-25
sp|Q5ABG1|SET1_CANAL Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SET1 PE=3 SV=1 14 147 4.0E-25
sp|Q6CIT4|SET1_KLULA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SET1 PE=3 SV=1 14 147 1.0E-22
sp|Q75D88|SET1_ASHGO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SET1 PE=3 SV=2 17 147 2.0E-22
sp|P38827|SET1_YEAST Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SET1 PE=1 SV=1 20 147 2.0E-22
sp|Q4PB36|SET1_USTMA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SET1 PE=3 SV=1 14 147 1.0E-20
sp|Q6FKB1|SET1_CANGA Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SET1 PE=3 SV=1 24 147 6.0E-20
sp|Q5LJZ2|SET1_DROME Histone-lysine N-methyltransferase SETD1 OS=Drosophila melanogaster GN=Set1 PE=1 SV=1 16 147 3.0E-19
sp|Q9Y7R4|SET1_SCHPO Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=set1 PE=1 SV=1 9 147 2.0E-16
sp|Q1LY77|SE1BA_DANRE Histone-lysine N-methyltransferase SETD1B-A OS=Danio rerio GN=setd1ba PE=1 SV=2 16 147 4.0E-16
sp|Q66J90|SET1B_XENLA Histone-lysine N-methyltransferase SETD1B OS=Xenopus laevis GN=setd1b PE=2 SV=1 16 147 1.0E-14
sp|Q08D57|SET1B_XENTR Histone-lysine N-methyltransferase SETD1B OS=Xenopus tropicalis GN=setd1b PE=2 SV=1 16 147 1.0E-14
sp|Q18221|SET2_CAEEL Probable histone-lysine N-methyltransferase set-2 OS=Caenorhabditis elegans GN=set-2 PE=2 SV=2 81 147 9.0E-13
sp|O15047|SET1A_HUMAN Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens GN=SETD1A PE=1 SV=3 14 147 1.0E-10
sp|P0CO27|SET1_CRYNB Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SET1 PE=3 SV=1 9 147 4.0E-10
sp|P0CO26|SET1_CRYNJ Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SET1 PE=3 SV=1 9 147 4.0E-10
sp|Q5F3P8|SET1B_CHICK Histone-lysine N-methyltransferase SETD1B OS=Gallus gallus GN=SETD1B PE=2 SV=1 16 147 3.0E-09
sp|Q9UPS6|SET1B_HUMAN Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens GN=SETD1B PE=1 SV=3 16 147 4.0E-09
sp|Q8CFT2|SET1B_MOUSE Histone-lysine N-methyltransferase SETD1B OS=Mus musculus GN=Setd1b PE=1 SV=2 16 147 1.0E-08
sp|F4K1J4|ATXR7_ARATH Histone-lysine N-methyltransferase ATXR7 OS=Arabidopsis thaliana GN=ATXR7 PE=2 SV=1 12 147 1.0E-08
sp|Q54HS3|SET1_DICDI Histone-lysine N-methyltransferase set1 OS=Dictyostelium discoideum GN=set1 PE=1 SV=1 7 147 8.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6190
MDQPVSINGYYVPNSTGCARTEGVKKILNSEKSKYLPHHIKVQKAREEREARFKKNGKDTSAAASEAAKLAAEKL
IAKGNSRANRASNRRYVADLNDQKKTLGQDSDVFKFNQLKKRKKPVKFARSAIHNWGLYAMENIGKDDMIIETAI
*
Coding >Hirsu2|6190
ATGGACCAGCCTGTGTCTATTAACGGGTATTACGTACCAAACTCCACTGGTTGTGCGCGAACCGAAGGTGTCAAG
AAGATACTGAACTCGGAAAAGTCGAAGTATCTGCCTCACCACATCAAGGTGCAGAAAGCGCGGGAGGAAAGGGAG
GCCCGCTTCAAGAAGAACGGGAAAGACACAAGCGCGGCTGCGTCTGAAGCTGCCAAACTGGCTGCCGAGAAACTT
ATAGCCAAGGGCAACTCGCGAGCCAACCGGGCCAGCAATCGCCGCTACGTGGCCGACCTCAACGATCAGAAAAAG
ACGCTGGGCCAGGACTCAGACGTGTTCAAGTTCAACCAGCTAAAGAAGCGGAAGAAGCCGGTCAAGTTCGCGCGG
TCGGCCATACACAACTGGGGCCTGTATGCCATGGAGAACATCGGTAAGGACGACATGATTATCGAAACCGCTATC
TGA
Transcript >Hirsu2|6190
ATGGACCAGCCTGTGTCTATTAACGGGTATTACGTACCAAACTCCACTGGTTGTGCGCGAACCGAAGGTGTCAAG
AAGATACTGAACTCGGAAAAGTCGAAGTATCTGCCTCACCACATCAAGGTGCAGAAAGCGCGGGAGGAAAGGGAG
GCCCGCTTCAAGAAGAACGGGAAAGACACAAGCGCGGCTGCGTCTGAAGCTGCCAAACTGGCTGCCGAGAAACTT
ATAGCCAAGGGCAACTCGCGAGCCAACCGGGCCAGCAATCGCCGCTACGTGGCCGACCTCAACGATCAGAAAAAG
ACGCTGGGCCAGGACTCAGACGTGTTCAAGTTCAACCAGCTAAAGAAGCGGAAGAAGCCGGTCAAGTTCGCGCGG
TCGGCCATACACAACTGGGGCCTGTATGCCATGGAGAACATCGGTAAGGACGACATGATTATCGAAACCGCTATC
TGA
Gene >Hirsu2|6190
ATGGACCAGCCTGTGTCTATTAACGGGTATTACGTACCAAACTCCACTGGTTGTGCGCGAACCGAAGGTGTCAAG
AAGATACTGAACTCGGAAAAGTCGAAGTATCTGCCTCACCACATCAAGGTGCAGAAAGCGCGGGAGGAAAGGGAG
GCCCGCTTCAAGAAGAACGGGAAAGACACAAGCGCGGCTGCGTCTGAAGCTGCCAAACTGGCTGCCGAGAAACTT
ATAGCCAAGGGCAACTCGCGAGCCAACCGGGCCAGCAATCGCCGCTACGTGGCCGACCTCAACGATCAGAAAAAG
ACGCTGGGCCAGGACTCAGACGTGTTCAAGTTCAACCAGCTAAAGAAGCGGAAGAAGCCGGTCAAGTTCGCGCGG
TCGGCCATACACAACTGGGGCCTGTATGCCATGGAGAACATCGGTAAGGACGACATGATTATCGAGTACGTCGGC
GAGGAGGTGCGGCAGCAGATTGCAGAGATCCGCGAGAACCGCTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail