Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6185
Gene name
LocationContig_314:18648..21227
Strand+
Gene length (bp)2579
Transcript length (bp)1932
Coding sequence length (bp)1932
Protein length (aa) 644

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06398 Pex24p Integral peroxisomal membrane peroxin 2.7E-93 73 493

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q06169|PEX30_YEAST Peroxisomal membrane protein PEX30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX30 PE=1 SV=1 75 513 5.0E-47
sp|P53203|PEX31_YEAST Peroxisomal membrane protein PEX31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX31 PE=1 SV=1 75 534 6.0E-40

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6185
MAAIDSPWLSSVGALMSARDDSSSVGAAPSSSAFDSSQGATGLPPTFAAFSPVTISASTPSRSARRSTILVHQKS
PLLLATPPQVTRALAYSHPFVLLLNQLAGLLTWSTGDPWQSFLLLSAFWAIVLYGDVVVRRAGPVLLGIVLIAGM
YGRRYSPLSSSGWSEPARQAKDAAPAAAPASGQPKDVKGNVADSTATAPGKAGHHRTQSQVTGAKHQKTLDEIVD
TLKEFTGRCNVLMDPLLEMTDFLSTQRTPTSATTKPALTAMFVRLLVVTPFWLALTMPPWRVITTRRVVLVAGTL
VLTWHARVMRVSRTILWRSATVRRLAAAITGLRFDRPAKGPRALEKLDSSSTAGSSRTAGAQAKSQRKAGSAKSA
GVKFTFIIYENQRRWVGLGWTSSLFAYERPAWTDEHNNAAPAKDDFELPEVEDGSQMRWQWAHGSRWRVDGVPDE
HGPVDYDSDEGRNGWVYYDNKWQNGRRGQDGWGKWTRRRKWYRDADLVEVDPSDTDTAPAAANGPAGGPHTQRYS
TAGEKMVTPMRAEPMLPGPDQTVADDASAKTADDAASLHSTSSKSSSFWPQSLRRRPAERPRTSAERDRSRRLSE
VPADAASEEDAARLGLEVELELQKQGKDGGQWGIGDEARMNLE*
Coding >Hirsu2|6185
ATGGCCGCAATAGACTCGCCCTGGCTGTCATCCGTGGGCGCGCTAATGTCTGCTCGCGACGACTCCTCCTCGGTC
GGCGCCGCGCCCTCCTCGTCCGCCTTCGACTCCTCCCAGGGCGCGACCGGCCTGCCTCCGACCTTCGCCGCCTTC
TCCCCCGTCACCATCTCCGCCAGCACCCCGTCGCGCTCCGCCCGCCGCTCCACCATCCTCGTCCACCAGAAGAGC
CCGCTGCTGCTGGCGACGCCGCCCCAGGTCACCCGTGCCCTGGCCTATAGCCACCCCTTCGTCCTCCTGCTCAAC
CAGCTCGCCGGCCTGCTCACCTGGAGCACCGGCGATCCCTGGCAGAGCTTCCTACTGCTCTCCGCCTTCTGGGCC
ATCGTCCTCTATGGCGATGTCGTCGTCCGCCGCGCCGGTCCCGTCCTCCTCGGCATTGTCCTCATAGCTGGCATG
TACGGCCGCCGGTACAGTCCCCTGAGCAGCAGCGGTTGGAGCGAGCCGGCGCGCCAAGCCAAGGATGCTGCTCCC
GCCGCCGCCCCCGCCTCGGGCCAGCCAAAGGACGTCAAGGGTAACGTCGCTGACAGCACCGCAACCGCCCCCGGC
AAGGCCGGACACCACAGGACACAATCGCAGGTTACCGGCGCCAAGCACCAGAAGACGCTCGACGAGATCGTCGAT
ACCCTCAAGGAGTTCACCGGCAGATGCAACGTCCTCATGGACCCCCTGCTCGAGATGACCGACTTTTTGAGTACC
CAGAGGACCCCGACGAGCGCGACGACCAAGCCCGCCCTGACCGCCATGTTCGTGCGCCTCCTCGTCGTCACGCCC
TTTTGGCTCGCCCTCACCATGCCTCCCTGGAGAGTCATCACCACCCGACGCGTCGTCCTCGTCGCCGGCACCCTG
GTCTTGACCTGGCATGCGAGGGTCATGCGCGTGTCGCGCACCATCTTGTGGAGGAGCGCGACGGTCCGCAGGCTC
GCAGCAGCCATCACCGGCCTGCGTTTTGACCGCCCCGCAAAGGGTCCCCGGGCTTTGGAGAAGCTTGACTCGAGC
TCGACCGCCGGCTCCAGCAGGACGGCAGGCGCGCAAGCCAAGAGCCAGCGAAAAGCGGGCTCCGCCAAGAGCGCC
GGCGTCAAGTTCACCTTCATCATTTACGAGAATCAGCGGCGATGGGTTGGCCTGGGATGGACCTCGAGTCTCTTC
GCCTACGAGCGCCCCGCCTGGACCGACGAGCACAACAACGCGGCGCCTGCCAAGGATGACTTCGAGCTCCCAGAG
GTCGAGGACGGCAGCCAGATGCGCTGGCAGTGGGCCCACGGCAGCCGCTGGCGGGTCGACGGCGTGCCCGACGAG
CATGGGCCCGTCGACTACGACAGCGACGAGGGGAGGAACGGATGGGTCTACTACGATAACAAGTGGCAAAACGGC
CGCCGAGGCCAGGACGGCTGGGGCAAGTGGACTCGCCGGAGGAAATGGTATCGCGACGCGGACCTAGTCGAGGTC
GACCCATCCGACACTGACACGGCCCCGGCCGCCGCCAACGGTCCCGCCGGCGGCCCTCACACGCAGCGCTACAGC
ACGGCGGGCGAGAAGATGGTGACGCCCATGCGCGCCGAACCGATGCTCCCCGGCCCGGACCAGACCGTGGCCGAC
GACGCCAGCGCCAAGACGGCCGACGACGCCGCCTCCCTTCATTCGACCTCGTCCAAATCGTCGTCCTTTTGGCCT
CAGTCTCTCAGGAGACGGCCTGCCGAGCGGCCGCGGACGTCGGCCGAAAGGGACCGTTCCCGGCGCCTGAGCGAG
GTGCCCGCCGATGCCGCCAGCGAGGAGGACGCTGCCAGACTGGGCTTAGAAGTCGAGCTGGAGCTGCAAAAACAG
GGCAAGGACGGGGGTCAGTGGGGGATTGGCGACGAAGCCCGGATGAATCTGGAGTGA
Transcript >Hirsu2|6185
ATGGCCGCAATAGACTCGCCCTGGCTGTCATCCGTGGGCGCGCTAATGTCTGCTCGCGACGACTCCTCCTCGGTC
GGCGCCGCGCCCTCCTCGTCCGCCTTCGACTCCTCCCAGGGCGCGACCGGCCTGCCTCCGACCTTCGCCGCCTTC
TCCCCCGTCACCATCTCCGCCAGCACCCCGTCGCGCTCCGCCCGCCGCTCCACCATCCTCGTCCACCAGAAGAGC
CCGCTGCTGCTGGCGACGCCGCCCCAGGTCACCCGTGCCCTGGCCTATAGCCACCCCTTCGTCCTCCTGCTCAAC
CAGCTCGCCGGCCTGCTCACCTGGAGCACCGGCGATCCCTGGCAGAGCTTCCTACTGCTCTCCGCCTTCTGGGCC
ATCGTCCTCTATGGCGATGTCGTCGTCCGCCGCGCCGGTCCCGTCCTCCTCGGCATTGTCCTCATAGCTGGCATG
TACGGCCGCCGGTACAGTCCCCTGAGCAGCAGCGGTTGGAGCGAGCCGGCGCGCCAAGCCAAGGATGCTGCTCCC
GCCGCCGCCCCCGCCTCGGGCCAGCCAAAGGACGTCAAGGGTAACGTCGCTGACAGCACCGCAACCGCCCCCGGC
AAGGCCGGACACCACAGGACACAATCGCAGGTTACCGGCGCCAAGCACCAGAAGACGCTCGACGAGATCGTCGAT
ACCCTCAAGGAGTTCACCGGCAGATGCAACGTCCTCATGGACCCCCTGCTCGAGATGACCGACTTTTTGAGTACC
CAGAGGACCCCGACGAGCGCGACGACCAAGCCCGCCCTGACCGCCATGTTCGTGCGCCTCCTCGTCGTCACGCCC
TTTTGGCTCGCCCTCACCATGCCTCCCTGGAGAGTCATCACCACCCGACGCGTCGTCCTCGTCGCCGGCACCCTG
GTCTTGACCTGGCATGCGAGGGTCATGCGCGTGTCGCGCACCATCTTGTGGAGGAGCGCGACGGTCCGCAGGCTC
GCAGCAGCCATCACCGGCCTGCGTTTTGACCGCCCCGCAAAGGGTCCCCGGGCTTTGGAGAAGCTTGACTCGAGC
TCGACCGCCGGCTCCAGCAGGACGGCAGGCGCGCAAGCCAAGAGCCAGCGAAAAGCGGGCTCCGCCAAGAGCGCC
GGCGTCAAGTTCACCTTCATCATTTACGAGAATCAGCGGCGATGGGTTGGCCTGGGATGGACCTCGAGTCTCTTC
GCCTACGAGCGCCCCGCCTGGACCGACGAGCACAACAACGCGGCGCCTGCCAAGGATGACTTCGAGCTCCCAGAG
GTCGAGGACGGCAGCCAGATGCGCTGGCAGTGGGCCCACGGCAGCCGCTGGCGGGTCGACGGCGTGCCCGACGAG
CATGGGCCCGTCGACTACGACAGCGACGAGGGGAGGAACGGATGGGTCTACTACGATAACAAGTGGCAAAACGGC
CGCCGAGGCCAGGACGGCTGGGGCAAGTGGACTCGCCGGAGGAAATGGTATCGCGACGCGGACCTAGTCGAGGTC
GACCCATCCGACACTGACACGGCCCCGGCCGCCGCCAACGGTCCCGCCGGCGGCCCTCACACGCAGCGCTACAGC
ACGGCGGGCGAGAAGATGGTGACGCCCATGCGCGCCGAACCGATGCTCCCCGGCCCGGACCAGACCGTGGCCGAC
GACGCCAGCGCCAAGACGGCCGACGACGCCGCCTCCCTTCATTCGACCTCGTCCAAATCGTCGTCCTTTTGGCCT
CAGTCTCTCAGGAGACGGCCTGCCGAGCGGCCGCGGACGTCGGCCGAAAGGGACCGTTCCCGGCGCCTGAGCGAG
GTGCCCGCCGATGCCGCCAGCGAGGAGGACGCTGCCAGACTGGGCTTAGAAGTCGAGCTGGAGCTGCAAAAACAG
GGCAAGGACGGGGGTCAGTGGGGGATTGGCGACGAAGCCCGGATGAATCTGGAGTGA
Gene >Hirsu2|6185
ATGGCCGCAATAGTGAGTGCCGTGTCCTTTCTTCCTCTTCCCCTCCCTGCCCTCTCCTCTCCTCTCCTCTGCCAT
TCCTCTCCCTTCCTCTCCTCTGCCATTCCTCTGCCTCGCCCCTTGACGCCGGATCTTTTTTTTTTTTTTGTGTGG
TCGCATTTTGCCTCCCGCCTACGGCCTCTCTCTTTTTTTTCCTGCCCTGCCGCGGCCCCTTCCCCGGCCCGGCCA
TGCCGCCAACGATGGCCGCCTTGTTCGTCTCTCCTCGTCCGCCTCGTCCTCGTCCTTAGCCTCCTCAGCCTCCCT
CCACCTCAACCTCCCGCCTCAGCCTCGTCTTCAACCTCGTCCTCTTCCGTCCTTCCGGCCGCCCTCGCCTCTCGA
TGCGGCCACATGCGACTCTTCCCGTTTCTGCGGGGCGCGGCATGTGATGCACCGAGATCCGCCTCTGTTTTTCCG
GGCCTCCCCCCTCTGAGCCCTTCCAACGTCCACGTCACTGCCGTTGCAGTACGAAACATCGCGTCATCCATGTCT
TGCGCTGCCCTCGCCCGCTCGCACCGTCGCTCTCGGAGCCCGCCTCGAGCTAGCTGACCCTCTCGCTTCCTCAGG
ACTCGCCCTGGCTGTCATCCGTGGGCGCGCTAATGTCTGCTCGCGACGACTCCTCCTCGGTCGGCGCCGCGCCCT
CCTCGTCCGCCTTCGACTCCTCCCAGGGCGCGACCGGCCTGCCTCCGACCTTCGCCGCCTTCTCCCCCGTCACCA
TCTCCGCCAGCACCCCGTCGCGCTCCGCCCGCCGCTCCACCATCCTCGTCCACCAGAAGAGCCCGCTGCTGCTGG
CGACGCCGCCCCAGGTCACCCGTGCCCTGGCCTATAGCCACCCCTTCGTCCTCCTGCTCAACCAGCTCGCCGGCC
TGCTCACCTGGAGCACCGGCGATCCCTGGCAGAGCTTCCTACTGCTCTCCGCCTTCTGGGCCATCGTCCTCTATG
GCGATGTCGTCGTCCGCCGCGCCGGTCCCGTCCTCCTCGGCATTGTCCTCATAGCTGGCATGTACGGCCGCCGGT
ACAGTCCCCTGAGCAGCAGCGGTTGGAGCGAGCCGGCGCGCCAAGCCAAGGATGCTGCTCCCGCCGCCGCCCCCG
CCTCGGGCCAGCCAAAGGACGTCAAGGGTAACGTCGCTGACAGCACCGCAACCGCCCCCGGCAAGGCCGGACACC
ACAGGACACAATCGCAGGTTACCGGCGCCAAGCACCAGAAGACGCTCGACGAGATCGTCGATACCCTCAAGGAGT
TCACCGGCAGATGCAACGTCCTCATGGACCCCCTGCTCGAGATGACCGACTTTTTGAGTACCCAGAGGACCCCGA
CGAGCGCGACGACCAAGCCCGCCCTGACCGCCATGTTCGTGCGCCTCCTCGTCGTCACGCCCTTTTGGCTCGCCC
TCACCATGCCTCCCTGGAGAGTCATCACCACCCGACGCGTCGTCCTCGTCGCCGGCACCCTGGTCTTGACCTGGC
ATGCGAGGGTCATGCGCGTGTCGCGCACCATCTTGTGGAGGAGCGCGACGGTCCGCAGGCTCGCAGCAGCCATCA
CCGGCCTGCGTTTTGACCGCCCCGCAAAGGGTCCCCGGGCTTTGGAGAAGCTTGACTCGAGCTCGACCGCCGGCT
CCAGCAGGACGGCAGGCGCGCAAGCCAAGAGCCAGCGAAAAGCGGGCTCCGCCAAGAGCGCCGGCGTCAAGTTCA
CCTTCATCATTTACGAGAATCAGCGGCGATGGGTTGGCCTGGGATGGACCTCGAGTCTCTTCGCCTACGAGCGCC
CCGCCTGGACCGACGAGCACAACAACGCGGCGCCTGCCAAGGATGACTTCGAGCTCCCAGAGGTCGAGGACGGCA
GCCAGATGCGCTGGCAGTGGGCCCACGGCAGCCGCTGGCGGGTCGACGGCGTGCCCGACGAGCATGGGCCCGTCG
ACTACGACAGCGACGAGGGGAGGAACGGATGGGTCTACTACGATAACAAGGTGAGACGAACCGTCCCCGGCCACG
GCCCGATGGTGGGCGCGCCGCTGATGCTCGCGCAGTGGCAAAACGGCCGCCGAGGCCAGGACGGCTGGGGCAAGT
GGACTCGCCGGAGGAAATGGTATCGCGACGCGGACCTAGTCGAGGTCGACCCATCCGACACTGACACGGCCCCGG
CCGCCGCCAACGGTCCCGCCGGCGGCCCTCACACGCAGCGCTACAGCACGGCGGGCGAGAAGATGGTGACGCCCA
TGCGCGCCGAACCGATGCTCCCCGGCCCGGACCAGACCGTGGCCGACGACGCCAGCGCCAAGACGGCCGACGACG
CCGCCTCCCTTCATTCGACCTCGTCCAAATCGTCGTCCTTTTGGCCTCAGTCTCTCAGGAGACGGCCTGCCGAGC
GGCCGCGGACGTCGGCCGAAAGGGACCGTTCCCGGCGCCTGAGCGAGGTGCCCGCCGATGCCGCCAGCGAGGAGG
ACGCTGCCAGACTGGGCTTAGAAGTCGAGCTGGAGCTGCAAAAACAGGGCAAGGACGGGGGTCAGTGGGGGATTG
GCGACGAAGCCCGGATGAATCTGGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail