Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6179
Gene name
LocationContig_314:965..2657
Strand+
Gene length (bp)1692
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 8.2E-19 98 216
PF13649 Methyltransf_25 Methyltransferase domain 9.6E-13 120 208
PF08241 Methyltransf_11 Methyltransferase domain 1.0E-11 121 211
PF08242 Methyltransf_12 Methyltransferase domain 3.8E-08 121 210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 107 269 3.0E-07
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 119 214 3.0E-07
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 107 269 5.0E-07
sp|C5CSI6|TAM_VARPS Trans-aconitate 2-methyltransferase OS=Variovorax paradoxus (strain S110) GN=tam PE=3 SV=1 115 214 1.0E-06
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 102 269 1.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M571|PEAMT_SPIOL Phosphoethanolamine N-methyltransferase OS=Spinacia oleracea GN=PEAMT PE=1 SV=1 107 269 3.0E-07
sp|Q9RX93|TAM_DEIRA Trans-aconitate 2-methyltransferase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tam PE=3 SV=1 119 214 3.0E-07
sp|Q944H0|PEAM2_ARATH Phosphomethylethanolamine N-methyltransferase OS=Arabidopsis thaliana GN=NMT2 PE=2 SV=2 107 269 5.0E-07
sp|C5CSI6|TAM_VARPS Trans-aconitate 2-methyltransferase OS=Variovorax paradoxus (strain S110) GN=tam PE=3 SV=1 115 214 1.0E-06
sp|Q9C6B9|PEAM3_ARATH Phosphoethanolamine N-methyltransferase 3 OS=Arabidopsis thaliana GN=NMT3 PE=2 SV=2 102 269 1.0E-06
sp|Q98K73|TAM_RHILO Trans-aconitate 2-methyltransferase OS=Rhizobium loti (strain MAFF303099) GN=tam PE=3 SV=1 117 250 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6179
MPSPSCPRLAAGDAACDAAAAAAGLSASHEPASDSAVEDDDDEADELESNASSLTSITSSVLYGVVAEGQRTYAV
YGKEEYGFPMDDREMDRMDLCHSMYYALLDKKRFLAPIDPQPHRILDLGCGTGIWAVDVADEHPSAEVVGVDIAP
TQPDWVPPNCSFELDDVEQPWTWKEGAADFIFGRDLFLSIRDFPKLIDQCYRHLKPGGWLEFQCVTGIVQCDDGT
VPPDSAYQSMSDNVGAACRAFGTPVDDPLRWKNLLSDRGFEAVVQKVYKLPCSPWAVDKRLKLVGMWEQHHLLNN
VDGMIMRLFHKGLGWTEQEILVFGALFRKDLKNLAMHAYFPYYVVYGRKPL*
Coding >Hirsu2|6179
ATGCCGAGCCCGTCTTGCCCTCGTCTTGCTGCCGGCGACGCTGCCTGCGACGCTGCCGCTGCCGCTGCCGGGCTC
TCGGCCTCGCACGAGCCAGCCTCGGACTCAGCCGTGGAGGACGACGACGATGAGGCCGACGAGCTCGAAAGCAAT
GCCAGCTCGCTCACGTCCATCACGTCGTCTGTCCTGTACGGCGTCGTGGCCGAGGGCCAGCGAACGTATGCCGTC
TACGGCAAAGAGGAATACGGCTTCCCCATGGACGATCGGGAGATGGATCGGATGGACCTCTGCCACTCGATGTAC
TACGCGCTTCTCGACAAGAAGCGCTTCCTGGCCCCGATCGACCCGCAGCCTCACAGGATCCTGGACCTAGGATGC
GGGACAGGCATCTGGGCCGTCGACGTGGCCGACGAGCATCCCAGCGCAGAGGTCGTGGGCGTCGACATAGCTCCG
ACACAGCCTGACTGGGTGCCTCCGAACTGCTCCTTCGAGCTCGACGACGTCGAACAGCCGTGGACGTGGAAGGAG
GGCGCGGCAGACTTCATCTTCGGCCGCGACCTCTTCCTCTCCATCCGCGACTTTCCGAAGCTCATCGACCAGTGC
TACAGGCACCTGAAGCCCGGCGGATGGCTGGAGTTCCAGTGCGTCACGGGCATCGTCCAGTGCGACGACGGCACG
GTGCCTCCGGACAGCGCCTACCAGAGCATGTCGGATAACGTGGGCGCGGCCTGCAGAGCGTTCGGGACGCCCGTG
GACGACCCCCTGCGCTGGAAGAACTTGCTATCGGACCGGGGCTTCGAGGCGGTAGTCCAAAAGGTGTACAAGCTG
CCCTGCTCTCCCTGGGCCGTCGATAAGCGCCTGAAGCTGGTGGGCATGTGGGAGCAGCACCACCTCCTCAACAAC
GTCGACGGCATGATTATGAGGCTCTTCCACAAGGGCCTGGGCTGGACGGAACAGGAGATTCTCGTCTTCGGGGCC
TTGTTCCGAAAGGACTTGAAGAACCTGGCCATGCATGCCTACTTTCCATATTACGTCGTCTACGGACGCAAACCG
CTCTAG
Transcript >Hirsu2|6179
ATGCCGAGCCCGTCTTGCCCTCGTCTTGCTGCCGGCGACGCTGCCTGCGACGCTGCCGCTGCCGCTGCCGGGCTC
TCGGCCTCGCACGAGCCAGCCTCGGACTCAGCCGTGGAGGACGACGACGATGAGGCCGACGAGCTCGAAAGCAAT
GCCAGCTCGCTCACGTCCATCACGTCGTCTGTCCTGTACGGCGTCGTGGCCGAGGGCCAGCGAACGTATGCCGTC
TACGGCAAAGAGGAATACGGCTTCCCCATGGACGATCGGGAGATGGATCGGATGGACCTCTGCCACTCGATGTAC
TACGCGCTTCTCGACAAGAAGCGCTTCCTGGCCCCGATCGACCCGCAGCCTCACAGGATCCTGGACCTAGGATGC
GGGACAGGCATCTGGGCCGTCGACGTGGCCGACGAGCATCCCAGCGCAGAGGTCGTGGGCGTCGACATAGCTCCG
ACACAGCCTGACTGGGTGCCTCCGAACTGCTCCTTCGAGCTCGACGACGTCGAACAGCCGTGGACGTGGAAGGAG
GGCGCGGCAGACTTCATCTTCGGCCGCGACCTCTTCCTCTCCATCCGCGACTTTCCGAAGCTCATCGACCAGTGC
TACAGGCACCTGAAGCCCGGCGGATGGCTGGAGTTCCAGTGCGTCACGGGCATCGTCCAGTGCGACGACGGCACG
GTGCCTCCGGACAGCGCCTACCAGAGCATGTCGGATAACGTGGGCGCGGCCTGCAGAGCGTTCGGGACGCCCGTG
GACGACCCCCTGCGCTGGAAGAACTTGCTATCGGACCGGGGCTTCGAGGCGGTAGTCCAAAAGGTGTACAAGCTG
CCCTGCTCTCCCTGGGCCGTCGATAAGCGCCTGAAGCTGGTGGGCATGTGGGAGCAGCACCACCTCCTCAACAAC
GTCGACGGCATGATTATGAGGCTCTTCCACAAGGGCCTGGGCTGGACGGAACAGGAGATTCTCGTCTTCGGGGCC
TTGTTCCGAAAGGACTTGAAGAACCTGGCCATGCATGCCTACTTTCCATATTACGTCGTCTACGGACGCAAACCG
CTCTAG
Gene >Hirsu2|6179
ATGCCGAGCCCGTCTTGCCCTCGTCTTGCTGCCGGCGACGCTGCCTGCGACGCTGCCGCTGCCGCTGCCGGGCTC
TCGGCCTCGCACGAGCCAGCCTCGGACTCAGCCGTGGAGGTGAGTTTGGACGGAGGAAAAGGCCGAACGCTACCA
CTACGCACCCACCCTCTCGGATGGCTGACAGCCGGCCAGGACGACGACGATGAGGTTCGTGCTTCAGTGCATACG
CTTGCTTTGACCCTCTGGCAGCCTCTCGAGTCTGTGTGGCGGCTGAGTCCAATCAGGCCGACGAGCTCGAAAGCA
ATGCCAGCTCGCTCACGTCCATCACGTCGTCTGTCCTGTACGGCGTCGTGGCCGAGGGCCAGCGAACGTATGCCG
TCTACGGCAAAGAGGGTGAGCCGCCTCGCGAGCCCATGTGTATCAGGAGGCGGCTGAGCGACGTGTCTGCCGGCA
GAATACGGCTTCCCCATGGACGATCGGGAGATGGATCGGATGGACCTCTGCCACTCGATGTACTACGCGCTTCTC
GACAAGAAGCGCTTCCTGGCCCCGATCGACCCGCAGCCTCACAGGATCCTGGACCTAGGATGCGGGACAGGTGAC
CGGCGACTGTTCTCTCGGGCGCGCAGAGGCTGACAGGTCGGCCAGGCATCTGGGCCGTCGACGTGGCCGACGAGC
ATCCCAGCGCAGAGGTAGGAACAACCTGCTTTCGCGCCACCGGGCCTCGGCAGAGCACTCATCGCCGGCACAGGT
CGTGGGCGTCGACATAGCTCCGACACAGCCTGACTGGTCAGTGAGGAACGCCCGGCAGTTGCGCCGAGCACCCGT
CCCCGATCCCCAACCGCTCATACGAAGCTTCGCAGGGTGCCTCCGAACTGCTCCTTCGAGCTCGACGACGTCGAA
CAGCCGTGGACGTGGAAGGAGGGCGCGGCAGACTTCATCTTCGGCCGCGACCTCTTCCTCTCCATCCGCGACTTT
CCGAAGCTCATCGACCAGTGCTACAGGTGCGGGCAGCCGTCCCCCTCCCCGTCCGTACCGTGCCTGTCCCGGGAA
CGGCTCGCTTACGCCGTCAACGTTCAGGCACCTGAAGCCCGGCGGATGGCTGGAGTTCCAGTGCGTCACGGGCAT
CGTCCAGTGCGACGACGGCACGGTGCCTCCGGACAGCGCCTACCAGAGCATGTCGGATAACGTGGGCGCGGCCTG
CAGAGCGTTCGGGACGCCCGTGGACGACCCCCTGCGCTGGAAGAACTTGCTATCGGACCGGGGCTTCGAGGCGGT
AGTCCAAAAGGTGTACAAGCTGCCCTGCTCTCCCTGGGCCGTCGATAAGCGCCTGAAGCTGGTGGGCATGTGGGA
GCAGCACCACCTCCTCAACAACGTCGACGGCATGATTATGAGGCTCTTCCACAAGGGCCTGGGCTGGACGGAACA
GGAGATTCTCGTCTTCGGGGCCTTGTTCCGAAAGGACTTGAAGAACCTGGCCATGCATGCCTACTTTCCATAGTG
AGTGGCCCCCGCATGTCCAGCACGGCGGTTGATCCCGCTCGCGGCGGGGCGGCCTGCAGCACGAACAAGTCCCTG
CCTCGACGAGTTCGGAGCCGGAGACCGGGGCTCTTCGGCATGAATCATGCGGACTGACCACGGCGTCAATTTCGG
GGACGGGATAGTTACGTCGTCTACGGACGCAAACCGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail