Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6173
Gene name
LocationContig_3134:228..989
Strand-
Gene length (bp)761
Transcript length (bp)594
Coding sequence length (bp)594
Protein length (aa) 198

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04603 Mog1 Ran-interacting Mog1 protein 1.3E-39 7 150

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54ML6|MOG1_DICDI Probable ran guanine nucleotide release factor OS=Dictyostelium discoideum GN=mog1 PE=3 SV=1 3 148 7.0E-17
sp|O75002|MOG1_SCHPO Nuclear import protein mog1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mog1 PE=3 SV=1 9 150 5.0E-10
sp|P47123|MOG1_YEAST Nuclear import protein MOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOG1 PE=1 SV=1 9 155 8.0E-10
sp|Q32PE2|MOG1_BOVIN Ran guanine nucleotide release factor OS=Bos taurus GN=RANGRF PE=2 SV=1 1 150 2.0E-08
sp|Q9HD47|MOG1_HUMAN Ran guanine nucleotide release factor OS=Homo sapiens GN=RANGRF PE=1 SV=1 8 150 3.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54ML6|MOG1_DICDI Probable ran guanine nucleotide release factor OS=Dictyostelium discoideum GN=mog1 PE=3 SV=1 3 148 7.0E-17
sp|O75002|MOG1_SCHPO Nuclear import protein mog1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mog1 PE=3 SV=1 9 150 5.0E-10
sp|P47123|MOG1_YEAST Nuclear import protein MOG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOG1 PE=1 SV=1 9 155 8.0E-10
sp|Q32PE2|MOG1_BOVIN Ran guanine nucleotide release factor OS=Bos taurus GN=RANGRF PE=2 SV=1 1 150 2.0E-08
sp|Q9HD47|MOG1_HUMAN Ran guanine nucleotide release factor OS=Homo sapiens GN=RANGRF PE=1 SV=1 8 150 3.0E-07
sp|Q9JIB0|MOG1_MOUSE Ran guanine nucleotide release factor OS=Mus musculus GN=Rangrf PE=1 SV=1 1 150 5.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6173
MSSYSATPLYGGAIVCDLPDNFADVSKLRQVPDNQEVWIDKNGFTSIIFDITERVGGPGCGPEIDGRAMTTHLED
MIGTESEKVRIWNTAETKFTRLESKLPAYTLIATQTPKVGRPREQASAPDFTAIIMTLVRLERCKTDVLITINVP
HIKGEYDEEDVDLELGKQGKHIGDAVMYADRIWKTLKIKDCSLFGEP*
Coding >Hirsu2|6173
ATGTCTTCCTATAGTGCCACGCCACTCTACGGTGGCGCTATAGTCTGCGACCTCCCGGACAATTTCGCCGATGTA
AGCAAACTCCGGCAAGTACCCGATAATCAGGAAGTATGGATCGACAAGAACGGCTTTACCAGCATCATTTTTGAT
ATCACTGAGCGGGTCGGCGGACCCGGCTGCGGCCCCGAGATCGATGGCCGTGCAATGACCACTCACCTAGAGGAC
ATGATCGGCACCGAGAGTGAGAAGGTCAGAATCTGGAACACGGCCGAGACCAAGTTTACTCGTCTGGAATCCAAA
CTCCCAGCCTACACACTTATTGCTACCCAGACGCCGAAGGTCGGACGGCCGCGGGAACAGGCTTCCGCTCCCGAT
TTCACTGCCATTATTATGACCCTCGTTCGTCTCGAGCGCTGCAAAACAGATGTTCTCATCACCATTAACGTGCCA
CATATAAAAGGCGAATATGACGAGGAGGATGTCGATCTCGAGCTCGGCAAACAAGGAAAGCATATTGGCGATGCC
GTCATGTACGCGGACCGCATCTGGAAGACACTCAAAATCAAGGACTGCAGTCTATTCGGCGAGCCGTAA
Transcript >Hirsu2|6173
ATGTCTTCCTATAGTGCCACGCCACTCTACGGTGGCGCTATAGTCTGCGACCTCCCGGACAATTTCGCCGATGTA
AGCAAACTCCGGCAAGTACCCGATAATCAGGAAGTATGGATCGACAAGAACGGCTTTACCAGCATCATTTTTGAT
ATCACTGAGCGGGTCGGCGGACCCGGCTGCGGCCCCGAGATCGATGGCCGTGCAATGACCACTCACCTAGAGGAC
ATGATCGGCACCGAGAGTGAGAAGGTCAGAATCTGGAACACGGCCGAGACCAAGTTTACTCGTCTGGAATCCAAA
CTCCCAGCCTACACACTTATTGCTACCCAGACGCCGAAGGTCGGACGGCCGCGGGAACAGGCTTCCGCTCCCGAT
TTCACTGCCATTATTATGACCCTCGTTCGTCTCGAGCGCTGCAAAACAGATGTTCTCATCACCATTAACGTGCCA
CATATAAAAGGCGAATATGACGAGGAGGATGTCGATCTCGAGCTCGGCAAACAAGGAAAGCATATTGGCGATGCC
GTCATGTACGCGGACCGCATCTGGAAGACACTCAAAATCAAGGACTGCAGTCTATTCGGCGAGCCGTAA
Gene >Hirsu2|6173
ATGTCTTCCTATAGTGCCACGCCACTCTACGGTGGCGCTATAGTCTGCGACCTCCCGGACAATTTCGCCGATGTA
AGGTAACAGCGGGCTTCCCCCCCTCCGTCCTCTTCAACGACCGTCGCAATGGTCACGACATCTCTAATTCGAAGC
TCCACCTCTACATTCAGCAAACTCCGGCAAGTACCCGATAATCAGGAAGTATGGATCGACAAGAACGGCTTTACC
AGCATCATTTTTGATATCACTGAGCGGGTCGGCGGACCCGGCTGCGGCCCCGAGATCGATGGCCGTGCAATGACC
ACTCACCTAGAGGACATGATCGGCACCGAGAGTGAGAAGGTCAGAATCTGGAACACGGCCGAGACCAAGTTTACT
CGTCTGGAGTAAGGCCGCTTCCTCACCCCTTATTACTTTTGAGCGAACAGATCAGTACCGGCTGAAGCGCGTCCA
CGGTGCCCAGATCCAAACTCCCAGCCTACACACTTATTGCTACCCAGACGCCGAAGGTCGGACGGCCGCGGGAAC
AGGCTTCCGCTCCCGATTTCACTGCCATTATTATGACCCTCGTTCGTCTCGAGCGCTGCAAAACAGATGTTCTCA
TCACCATTAACGTGCCACATATAAAAGGCGAATATGACGAGGAGGATGTCGATCTCGAGCTCGGCAAACAAGGAA
AGCATATTGGCGATGCCGTCATGTACGCGGACCGCATCTGGAAGACACTCAAAATCAAGGACTGCAGTCTATTCG
GCGAGCCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail