Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6172
Gene name
LocationContig_3133:67..1031
Strand+
Gene length (bp)964
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01061 ABC2_membrane ABC-2 type transporter 6.5E-36 2 197

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 5 291 1.0E-46
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 5 291 9.0E-45
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 5 292 1.0E-44
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 5 292 5.0E-44
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 5 291 5.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55GB1|ABCGF_DICDI ABC transporter G family member 15 OS=Dictyostelium discoideum GN=abcG15 PE=3 SV=1 5 291 1.0E-46
sp|Q556W2|ABCGH_DICDI ABC transporter G family member 17 OS=Dictyostelium discoideum GN=abcG17-1 PE=3 SV=1 5 291 9.0E-45
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 5 292 1.0E-44
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 5 292 5.0E-44
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 5 291 5.0E-44
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 5 292 1.0E-43
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 5 291 4.0E-43
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 6 291 2.0E-42
sp|P32568|SNQ2_YEAST Protein SNQ2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNQ2 PE=1 SV=2 4 302 1.0E-41
sp|P41820|BFR1_SCHPO Brefeldin A resistance protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bfr1 PE=1 SV=1 3 287 3.0E-39
sp|P53756|PDR18_YEAST ABC transporter ATP-binding protein/permease PDR18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR18 PE=3 SV=1 4 277 3.0E-36
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 4 297 1.0E-35
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 1 288 1.0E-35
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 5 292 1.0E-35
sp|P40550|PDR11_YEAST ATP-dependent permease PDR11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR11 PE=1 SV=3 7 302 2.0E-35
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 1 283 1.0E-34
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 1 288 1.0E-32
sp|Q08409|AUS1_YEAST ATP-dependent permease AUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AUS1 PE=3 SV=1 7 302 3.0E-31
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 6 289 1.0E-30
sp|Q04182|PDR15_YEAST ATP-dependent permease PDR15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR15 PE=1 SV=1 1 284 4.0E-29
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 6 277 7.0E-29
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 6 277 7.0E-29
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 1 287 4.0E-26
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 2 287 2.0E-23
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 4 201 3.0E-19
sp|Q7PC81|AB43G_ARATH ABC transporter G family member 43 OS=Arabidopsis thaliana GN=ABCG43 PE=3 SV=1 4 201 2.0E-18
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 4 201 1.0E-17
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 15 299 1.0E-17
sp|Q94A18|AB29G_ARATH ABC transporter G family member 29 OS=Arabidopsis thaliana GN=ABCG29 PE=2 SV=2 4 201 7.0E-17
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 1 201 2.0E-16
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 1 190 3.0E-16
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 15 284 6.0E-16
sp|Q9NGP5|ABCG2_DICDI ABC transporter G family member 2 OS=Dictyostelium discoideum GN=abcG2 PE=1 SV=2 14 192 1.0E-15
sp|Q8GU88|AB39G_ORYSJ ABC transporter G family member 39 OS=Oryza sativa subsp. japonica GN=ABCG39 PE=3 SV=1 3 182 1.0E-15
sp|Q7PC86|AB35G_ARATH ABC transporter G family member 35 OS=Arabidopsis thaliana GN=ABCG35 PE=2 SV=1 4 201 2.0E-15
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 69 302 4.0E-15
sp|Q6EQ60|AB47G_ORYSJ ABC transporter G family member 47 OS=Oryza sativa subsp. japonica GN=ABCG47 PE=3 SV=2 4 201 4.0E-15
sp|C7J6G6|AB46G_ORYSJ ABC transporter G family member 46 OS=Oryza sativa subsp. japonica GN=ABCG46 PE=3 SV=2 4 201 7.0E-15
sp|Q9M9E1|AB40G_ARATH ABC transporter G family member 40 OS=Arabidopsis thaliana GN=ABCG40 PE=1 SV=1 4 190 1.0E-14
sp|Q6YW62|AB44G_ORYSJ ABC transporter G family member 44 OS=Oryza sativa subsp. japonica GN=ABCG44 PE=2 SV=2 4 182 2.0E-14
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 4 201 2.0E-14
sp|Q9XIE2|AB36G_ARATH ABC transporter G family member 36 OS=Arabidopsis thaliana GN=ABCG36 PE=1 SV=1 4 235 2.0E-14
sp|B9G300|AB52G_ORYSJ ABC transporter G family member 52 OS=Oryza sativa subsp. japonica GN=ABCG52 PE=2 SV=2 4 235 3.0E-14
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 12 215 4.0E-14
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 4 201 4.0E-14
sp|A3BXL8|AB53G_ORYSJ ABC transporter G family member 53 OS=Oryza sativa subsp. japonica GN=ABCG53 PE=2 SV=1 4 201 5.0E-14
sp|O24367|TUR2_SPIPO Pleiotropic drug resistance protein TUR2 OS=Spirodela polyrhiza GN=TUR2 PE=1 SV=1 3 186 6.0E-14
sp|Q7FMW4|AB38G_ORYSJ ABC transporter G family member 38 OS=Oryza sativa subsp. japonica GN=ABCG38 PE=3 SV=1 4 201 8.0E-14
sp|Q8LQX2|AB32G_ORYSJ ABC transporter G family member 32 OS=Oryza sativa subsp. japonica GN=ABCG32 PE=2 SV=1 4 182 1.0E-13
sp|Q2QV81|AB49G_ORYSJ ABC transporter G family member 49 OS=Oryza sativa subsp. japonica GN=ABCG49 PE=2 SV=3 4 192 1.0E-13
sp|Q7PC84|AB39G_ARATH ABC transporter G family member 39 OS=Arabidopsis thaliana GN=ABCG39 PE=3 SV=1 4 206 2.0E-13
sp|Q54TV1|ABCG6_DICDI ABC transporter G family member 6 OS=Dictyostelium discoideum GN=abcG6 PE=3 SV=1 10 299 3.0E-13
sp|Q54TV2|ABCG5_DICDI ABC transporter G family member 5 OS=Dictyostelium discoideum GN=abcG5 PE=3 SV=1 8 299 3.0E-13
sp|Q7PC80|AB34G_ORYSJ ABC transporter G family member 34 OS=Oryza sativa subsp. japonica GN=ABCG34 PE=3 SV=1 4 182 5.0E-13
sp|Q8GU89|AB37G_ORYSJ ABC transporter G family member 37 OS=Oryza sativa subsp. japonica GN=ABCG37 PE=2 SV=1 4 182 5.0E-13
sp|Q76CU2|PDR1_TOBAC Pleiotropic drug resistance protein 1 OS=Nicotiana tabacum GN=PDR1 PE=2 SV=1 4 214 7.0E-13
sp|Q8GU92|AB35G_ORYSJ ABC transporter G family member 35 OS=Oryza sativa subsp. japonica GN=ABCG35 PE=3 SV=1 1 210 9.0E-13
sp|Q54HM0|ABCGG_DICDI ABC transporter G family member 16 OS=Dictyostelium discoideum GN=abcG16 PE=3 SV=1 7 215 2.0E-12
sp|Q7PC85|AB38G_ARATH ABC transporter G family member 38 OS=Arabidopsis thaliana GN=ABCG38 PE=2 SV=1 3 199 2.0E-12
sp|Q8GU87|AB31G_ORYSJ ABC transporter G family member 31 OS=Oryza sativa subsp. japonica GN=ABCG31 PE=2 SV=3 4 201 2.0E-12
sp|Q0JLC5|AB36G_ORYSJ ABC transporter G family member 36 OS=Oryza sativa subsp. japonica GN=ABCG36 PE=2 SV=1 4 182 2.0E-12
sp|A2WSH0|AB36G_ORYSI ABC transporter G family member 36 OS=Oryza sativa subsp. indica GN=ABCG36 PE=2 SV=1 4 182 2.0E-12
sp|Q7PC88|AB31G_ARATH ABC transporter G family member 31 OS=Arabidopsis thaliana GN=ABCG31 PE=1 SV=1 5 203 2.0E-12
sp|Q8GU82|AB45G_ORYSJ ABC transporter G family member 45 OS=Oryza sativa subsp. japonica GN=ABCG45 PE=2 SV=2 4 206 2.0E-12
sp|Q8GU83|AB41G_ORYSJ ABC transporter G family member 41 OS=Oryza sativa subsp. japonica GN=ABCG41 PE=3 SV=1 4 192 2.0E-12
sp|Q8T690|ABCG3_DICDI ABC transporter G family member 3 OS=Dictyostelium discoideum GN=abcG3 PE=3 SV=1 7 302 4.0E-12
sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 7 189 5.0E-12
sp|Q5Z9S8|AB42G_ORYSJ ABC transporter G family member 42 OS=Oryza sativa subsp. japonica GN=ABCG42 PE=2 SV=1 4 201 7.0E-12
sp|Q7PC83|AB41G_ARATH ABC transporter G family member 41 OS=Arabidopsis thaliana GN=ABCG41 PE=2 SV=1 4 201 8.0E-12
sp|Q949G3|PDR1_NICPL Pleiotropic drug resistance protein 1 OS=Nicotiana plumbaginifolia GN=PDR1 PE=1 SV=1 4 186 1.0E-11
sp|Q8GU84|AB48G_ORYSJ ABC transporter G family member 48 OS=Oryza sativa subsp. japonica GN=ABCG48 PE=3 SV=1 3 201 3.0E-11
sp|O42690|CDR3_CANAX Opaque-specific ABC transporter CDR3 OS=Candida albicans GN=CDR3 PE=2 SV=1 19 283 4.0E-11
sp|Q7PC87|AB34G_ARATH ABC transporter G family member 34 OS=Arabidopsis thaliana GN=ABCG34 PE=2 SV=1 1 206 1.0E-10
sp|Q8GU85|AB40G_ORYSJ ABC transporter G family member 40 OS=Oryza sativa subsp. japonica GN=ABCG40 PE=3 SV=2 3 206 2.0E-10
sp|Q8T673|ABCGL_DICDI ABC transporter G family member 21 OS=Dictyostelium discoideum GN=abcG21 PE=3 SV=1 6 192 4.0E-10
sp|Q8S628|AB51G_ORYSJ ABC transporter G family member 51 OS=Oryza sativa subsp. japonica GN=ABCG51 PE=3 SV=1 5 203 1.0E-09
sp|Q2PCF1|PDR2_NICPL Pleiotropic drug resistance protein 2 OS=Nicotiana plumbaginifolia GN=PDR2 PE=2 SV=1 4 235 2.0E-09
sp|Q9C0Y5|PDR1_SCHPO ATP-binding cassette transporter pdr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdr1 PE=3 SV=1 10 296 3.0E-09
sp|Q8T675|ABCGJ_DICDI ABC transporter G family member 19 OS=Dictyostelium discoideum GN=abcG19 PE=3 SV=1 1 192 5.0E-09
sp|O81016|AB32G_ARATH ABC transporter G family member 32 OS=Arabidopsis thaliana GN=ABCG32 PE=1 SV=1 4 224 7.0E-09
sp|B9GDE5|AB50G_ORYSJ ABC transporter G family member 50 OS=Oryza sativa subsp. japonica GN=ABCG50 PE=2 SV=2 12 199 8.0E-09
sp|P51533|PDR10_YEAST ATP-dependent permease PDR10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR10 PE=3 SV=1 1 296 1.0E-08
sp|Q8GU86|AB43G_ORYSJ ABC transporter G family member 43 OS=Oryza sativa subsp. japonica GN=ABCG43 PE=2 SV=2 3 201 1.0E-08
sp|Q55DR1|ABCGE_DICDI ABC transporter G family member 14 OS=Dictyostelium discoideum GN=abcG14 PE=3 SV=1 12 210 3.0E-08
sp|O74676|CDR4_CANAX ABC transporter CDR4 OS=Candida albicans GN=CDR4 PE=3 SV=1 8 283 3.0E-08
sp|Q54CG0|ABCGA_DICDI ABC transporter G family member 10 OS=Dictyostelium discoideum GN=abcG10 PE=3 SV=1 47 192 8.0E-08
sp|Q8T683|ABCG9_DICDI ABC transporter G family member 9 OS=Dictyostelium discoideum GN=abcG9 PE=3 SV=1 69 192 1.0E-07
sp|P43071|CDR1_CANAX Multidrug resistance protein CDR1 OS=Candida albicans GN=CDR1 PE=3 SV=1 3 282 1.0E-07
sp|Q5ANA3|CDR1_CANAL Pleiotropic ABC efflux transporter of multiple drugs CDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR1 PE=1 SV=1 3 282 1.0E-07
sp|Q55DQ2|ABCGB_DICDI ABC transporter G family member 11 OS=Dictyostelium discoideum GN=abcG11 PE=3 SV=1 3 211 3.0E-07
sp|Q9LFH0|AB37G_ARATH ABC transporter G family member 37 OS=Arabidopsis thaliana GN=ABCG37 PE=2 SV=1 29 216 3.0E-07
sp|Q02785|PDR12_YEAST ATP-dependent permease PDR12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR12 PE=1 SV=1 1 210 4.0E-07
sp|Q9ZUT8|AB33G_ARATH ABC transporter G family member 33 OS=Arabidopsis thaliana GN=ABCG33 PE=2 SV=1 20 216 5.0E-07
sp|Q8GZ52|AB30G_ARATH ABC transporter G family member 30 OS=Arabidopsis thaliana GN=ABCG30 PE=2 SV=2 70 192 6.0E-07
sp|Q5W274|PDR3_TOBAC Pleiotropic drug resistance protein 3 OS=Nicotiana tabacum GN=PDR3 PE=2 SV=1 1 192 9.0E-07
sp|O74208|PDH1_CANGA ATP-binding cassette transporter CGR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PDH1 PE=3 SV=3 1 283 1.0E-06
sp|Q7PC82|AB42G_ARATH ABC transporter G family member 42 OS=Arabidopsis thaliana GN=ABCG42 PE=2 SV=1 70 192 2.0E-06
sp|P33302|PDR5_YEAST Pleiotropic ABC efflux transporter of multiple drugs OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PDR5 PE=1 SV=1 1 296 3.0E-06
sp|P78595|CDR2_CANAL Multidrug resistance protein CDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CDR2 PE=3 SV=2 69 210 5.0E-06
sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=1 SV=2 4 185 8.0E-06
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 3 244 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 11 33 22
2 43 65 22
3 85 114 29
4 124 146 22
5 159 181 22
6 277 299 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6172
MMRSFWRSPNYLFTRLFNHLTVALINGLTYMGLDDSRSSLQYTVFVMFQVTVLPALVMAQVGVMFQLKRAVFFRE
ASAKMYSPLVFAAAMVAAELPWSLLCAVVFYLCIYFVPGLSAAPSRAGYQFLMVLGTELFAVSLGQGLAALTPSP
RIAAQLDPLIVIVFALFCGVTMPAPEMPAFWRAWLYQLDPFTRLVGGTVTTALHGRPVRCRPDELSRFAAPDGLS
CGRYMEPFFARGGAGYLVSNDTQACEYCAYRVGDDFYTPLGMSFSDRWRDCGIYFAFIASNLVILFTACRYLNFN
KR*
Coding >Hirsu2|6172
ATGATGCGGTCCTTCTGGCGGTCGCCCAACTACCTCTTCACCCGCCTCTTCAACCACCTGACCGTGGCGCTGATC
AACGGGCTGACGTACATGGGGCTGGACGACTCGCGGTCGTCGCTCCAGTACACCGTCTTCGTCATGTTCCAGGTG
ACGGTGCTGCCGGCGCTCGTCATGGCCCAGGTGGGCGTCATGTTCCAGCTCAAGCGCGCCGTCTTCTTCCGCGAG
GCCTCGGCCAAGATGTACTCGCCGCTCGTCTTCGCGGCCGCCATGGTGGCGGCGGAGCTGCCGTGGTCGCTCCTC
TGCGCCGTCGTCTTCTACCTCTGCATCTACTTCGTGCCGGGCCTGTCGGCGGCGCCCTCGCGCGCGGGCTACCAG
TTCCTCATGGTGCTCGGCACCGAGCTCTTCGCCGTCAGCCTGGGCCAGGGCCTGGCGGCGCTGACGCCGTCGCCG
CGCATCGCCGCCCAGCTGGACCCCTTGATCGTCATCGTCTTCGCCCTCTTCTGCGGCGTCACCATGCCGGCCCCG
GAGATGCCGGCCTTCTGGCGCGCCTGGCTGTACCAGCTCGACCCCTTCACCCGCCTCGTCGGCGGCACCGTCACC
ACCGCCCTGCACGGCCGGCCCGTCCGCTGCCGGCCCGACGAGCTCAGCCGGTTCGCCGCGCCCGACGGCCTCTCC
TGCGGCCGCTACATGGAGCCCTTCTTCGCCCGCGGCGGCGCCGGCTACCTCGTCAGCAACGACACCCAGGCCTGC
GAGTACTGCGCCTACCGCGTCGGCGACGACTTCTACACGCCCCTGGGCATGTCCTTCTCGGACCGCTGGCGCGAC
TGCGGCATCTACTTTGCCTTTATCGCCAGCAACCTCGTCATTCTCTTTACCGCGTGCCGGTATTTAAACTTCAAC
AAGAGATAG
Transcript >Hirsu2|6172
ATGATGCGGTCCTTCTGGCGGTCGCCCAACTACCTCTTCACCCGCCTCTTCAACCACCTGACCGTGGCGCTGATC
AACGGGCTGACGTACATGGGGCTGGACGACTCGCGGTCGTCGCTCCAGTACACCGTCTTCGTCATGTTCCAGGTG
ACGGTGCTGCCGGCGCTCGTCATGGCCCAGGTGGGCGTCATGTTCCAGCTCAAGCGCGCCGTCTTCTTCCGCGAG
GCCTCGGCCAAGATGTACTCGCCGCTCGTCTTCGCGGCCGCCATGGTGGCGGCGGAGCTGCCGTGGTCGCTCCTC
TGCGCCGTCGTCTTCTACCTCTGCATCTACTTCGTGCCGGGCCTGTCGGCGGCGCCCTCGCGCGCGGGCTACCAG
TTCCTCATGGTGCTCGGCACCGAGCTCTTCGCCGTCAGCCTGGGCCAGGGCCTGGCGGCGCTGACGCCGTCGCCG
CGCATCGCCGCCCAGCTGGACCCCTTGATCGTCATCGTCTTCGCCCTCTTCTGCGGCGTCACCATGCCGGCCCCG
GAGATGCCGGCCTTCTGGCGCGCCTGGCTGTACCAGCTCGACCCCTTCACCCGCCTCGTCGGCGGCACCGTCACC
ACCGCCCTGCACGGCCGGCCCGTCCGCTGCCGGCCCGACGAGCTCAGCCGGTTCGCCGCGCCCGACGGCCTCTCC
TGCGGCCGCTACATGGAGCCCTTCTTCGCCCGCGGCGGCGCCGGCTACCTCGTCAGCAACGACACCCAGGCCTGC
GAGTACTGCGCCTACCGCGTCGGCGACGACTTCTACACGCCCCTGGGCATGTCCTTCTCGGACCGCTGGCGCGAC
TGCGGCATCTACTTTGCCTTTATCGCCAGCAACCTCGTCATTCTCTTTACCGCGTGCCGGTATTTAAACTTCAAC
AAGAGATAG
Gene >Hirsu2|6172
ATGATGCGGTCCTTCTGGCGGTCGCCCAACTACCTCTTCACCCGCCTCTTCAACCACCTGACCGTGGCGCTGATC
AACGGGCTGACGTACATGGGGCTGGACGACTCGCGGTCGTCGCTCCAGTACACCGTCTTCGTCATGTTCCAGGTG
ACGGTGCTGCCGGCGCTCGTCATGGCCCAGGTGGGCGTCATGTTCCAGCTCAAGCGCGCCGTCTTCTTCCGCGAG
GCCTCGGCCAAGATGTACTCGCCGCTCGTCTTCGCGGCCGCCATGGTGGCGGCGGAGCTGCCGTGGTCGCTCCTC
TGCGCCGTCGTCTTCTACCTCTGCATCTACTTCGTGCCGGGCCTGTCGGCGGCGCCCTCGCGCGCGGGCTACCAG
TTCCTCATGGTGCTCGGCACCGAGCTCTTCGCCGTCAGCCTGGGCCAGGGCCTGGCGGCGCTGACGCCGTCGCCG
CGCATCGCCGCCCAGCTGGACCCCTTGATCGTCATCGTCTTCGCCCTCTTCTGCGGCGTCACCATGCCGGCCCCG
GAGATGCCGGCCTTCTGGCGCGCCTGGCTGTACCAGCTCGACCCCTTCACCCGCCTCGTCGGCGGCACCGTCACC
ACCGCCCTGCACGGCCGGCCCGTCCGCTGCCGGCCCGACGAGCTCAGCCGGTTCGCCGCGCCCGACGGCCTCTCC
TGCGGCCGCTACATGGAGCCCTTCTTCGCCCGCGGCGGCGCCGGCTACCTCGTCAGCAACGACACCCAGGCCTGC
GAGTACTGCGCCTACCGCGTCGGCGACGACTTCTACACGCCCCTGGGCATGTCCTTCTCGGACCGCTGGCGCGAC
TGCGGCATCTACTTTGCCTTTATCGCCAGCAACCTCGTCATTCTCTTTACCGCGGTCAGTCTTTGTCCCATGATT
GAACGTGACGCATGCATTGCTGACACTGAATCAGTGCCGGTATTTAAACTTCAACAAGAGATAG

© 2020 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail