Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6168
Gene name
LocationContig_313:11473..13046
Strand+
Gene length (bp)1573
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|E5QZI4|MEP7_ARTGP Extracellular metalloprotease MGYG_00389 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00389 PE=3 SV=1 167 310 5.0E-07
sp|D4DIV0|MEP7_TRIVH Extracellular metalloprotease TRV_07111 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_07111 PE=3 SV=1 173 314 2.0E-06
sp|D4ATD1|MEP7_ARTBC Extracellular metalloprotease ARB_07495 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07495 PE=3 SV=1 173 314 2.0E-06
sp|D4ALW9|MEP6_ARTBC Extracellular metalloprotease ARB_05317 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05317 PE=1 SV=1 175 314 3.0E-06
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 175 314 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|E5QZI4|MEP7_ARTGP Extracellular metalloprotease MGYG_00389 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_00389 PE=3 SV=1 167 310 5.0E-07
sp|D4DIV0|MEP7_TRIVH Extracellular metalloprotease TRV_07111 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_07111 PE=3 SV=1 173 314 2.0E-06
sp|D4ATD1|MEP7_ARTBC Extracellular metalloprotease ARB_07495 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07495 PE=3 SV=1 173 314 2.0E-06
sp|D4ALW9|MEP6_ARTBC Extracellular metalloprotease ARB_05317 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05317 PE=1 SV=1 175 314 3.0E-06
sp|D4DI84|MEP6_TRIVH Extracellular metalloprotease TRV_06892 OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_06892 PE=3 SV=2 175 314 3.0E-06
sp|E4V4I7|MEP6_ARTGP Extracellular metalloprotease MGYG_07913 OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_07913 PE=3 SV=1 175 314 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6168
MVVPSLFVASFIASAVVVAGPISAPSGDGDIISTCYTRDRTAEELRLLRRQLTFGGTANGSPLDDLTGNGITQDA
SQSGQQSPGQVPGQQSPGQVPGQQSPGQVPGQGLGQGSGGSSGNGKNGASPQSQNDSGNDLGDGTEAQNPGQTLP
PLKVAFHSCCTTPNDCTSTEDSKHQVDVLNENYQPCGISWTLANATAVTNENCDRTNLESENEVDNFKISTREGG
ADTMNVVVLPTNGGRGVKGKCYSPPAPGQGQGSIEQTVGNVDGCAIAMDLVKNNASEMETNNPPNGQSNTILSHE
AGHFLSLEHVPEGNEVRPGVQNIMVPFARFGNKYAFNQEQCQQMRAVVQKRLSDKKEIPKQGNPDQIAQGFGGGG
GGGSASSNGGRQPKPTGPSGPGGGSQPAPSGPSGPGAGGAGGGQSAPAGPNGAGGGVVGGGGGLDPFTTGGGGGG
GFPSTSYSGGGSEVSNDIDSFNPFGSGNPF*
Coding >Hirsu2|6168
ATGGTCGTGCCATCATTGTTCGTGGCCAGCTTCATCGCCTCGGCCGTTGTGGTGGCTGGTCCCATCAGCGCGCCC
TCCGGCGACGGAGACATCATAAGCACTTGTTACACACGCGACCGGACGGCAGAGGAGCTGAGACTTTTGCGGCGG
CAACTCACCTTCGGCGGAACCGCCAATGGTTCGCCGTTGGACGACTTGACCGGCAACGGAATCACCCAAGACGCC
TCGCAGTCCGGACAGCAAAGCCCCGGACAAGTTCCCGGACAGCAAAGCCCCGGACAGGTTCCCGGACAGCAAAGC
CCCGGACAAGTTCCGGGACAGGGTCTCGGACAGGGTTCCGGCGGAAGTTCCGGCAACGGGAAAAATGGAGCCTCG
CCGCAGTCTCAGAACGACAGTGGGAACGACTTGGGCGACGGGACAGAAGCACAGAATCCTGGACAGACGCTTCCA
CCCTTGAAGGTCGCCTTCCACTCCTGCTGCACGACGCCTAATGATTGCACCTCGACAGAGGACAGCAAGCACCAG
GTGGACGTACTCAACGAAAACTACCAGCCTTGCGGCATCAGCTGGACGCTGGCCAACGCCACGGCGGTGACCAAC
GAAAACTGCGACCGCACCAACCTGGAGAGCGAGAACGAGGTCGACAACTTCAAAATCAGCACCCGCGAGGGCGGC
GCCGACACGATGAACGTCGTCGTCCTGCCGACCAACGGCGGTCGCGGCGTCAAGGGCAAGTGCTATTCGCCCCCT
GCGCCTGGGCAGGGCCAAGGGTCGATCGAGCAGACGGTGGGCAACGTGGACGGCTGCGCCATCGCCATGGACCTG
GTCAAGAACAATGCGTCCGAGATGGAGACCAACAACCCGCCCAATGGCCAGAGCAACACGATCCTGAGCCACGAG
GCCGGCCACTTTCTCAGCCTGGAGCACGTCCCGGAGGGCAACGAGGTCAGGCCGGGCGTGCAGAACATCATGGTG
CCCTTTGCCCGTTTCGGCAACAAGTACGCCTTCAACCAAGAGCAGTGCCAGCAGATGAGGGCTGTGGTTCAGAAG
CGGCTCAGTGATAAGAAGGAAATTCCCAAGCAGGGGAACCCCGACCAGATCGCTCAGGGCTTCGGCGGCGGCGGC
GGCGGCGGCAGTGCCAGCAGCAACGGAGGCAGACAGCCGAAACCCACTGGCCCCAGCGGGCCTGGCGGAGGCAGT
CAGCCGGCGCCTTCTGGTCCCAGCGGGCCTGGCGCAGGTGGTGCCGGAGGAGGTCAGTCGGCGCCTGCTGGCCCT
AACGGAGCCGGCGGGGGCGTTGTTGGTGGCGGCGGAGGGCTCGATCCCTTCACGACTGGCGGAGGCGGAGGCGGA
GGATTCCCGTCGACGTCTTACAGTGGTGGTGGCAGCGAAGTGTCGAACGACATAGATTCGTTCAACCCCTTTGGC
TCGGGCAACCCGTTCTAG
Transcript >Hirsu2|6168
ATGGTCGTGCCATCATTGTTCGTGGCCAGCTTCATCGCCTCGGCCGTTGTGGTGGCTGGTCCCATCAGCGCGCCC
TCCGGCGACGGAGACATCATAAGCACTTGTTACACACGCGACCGGACGGCAGAGGAGCTGAGACTTTTGCGGCGG
CAACTCACCTTCGGCGGAACCGCCAATGGTTCGCCGTTGGACGACTTGACCGGCAACGGAATCACCCAAGACGCC
TCGCAGTCCGGACAGCAAAGCCCCGGACAAGTTCCCGGACAGCAAAGCCCCGGACAGGTTCCCGGACAGCAAAGC
CCCGGACAAGTTCCGGGACAGGGTCTCGGACAGGGTTCCGGCGGAAGTTCCGGCAACGGGAAAAATGGAGCCTCG
CCGCAGTCTCAGAACGACAGTGGGAACGACTTGGGCGACGGGACAGAAGCACAGAATCCTGGACAGACGCTTCCA
CCCTTGAAGGTCGCCTTCCACTCCTGCTGCACGACGCCTAATGATTGCACCTCGACAGAGGACAGCAAGCACCAG
GTGGACGTACTCAACGAAAACTACCAGCCTTGCGGCATCAGCTGGACGCTGGCCAACGCCACGGCGGTGACCAAC
GAAAACTGCGACCGCACCAACCTGGAGAGCGAGAACGAGGTCGACAACTTCAAAATCAGCACCCGCGAGGGCGGC
GCCGACACGATGAACGTCGTCGTCCTGCCGACCAACGGCGGTCGCGGCGTCAAGGGCAAGTGCTATTCGCCCCCT
GCGCCTGGGCAGGGCCAAGGGTCGATCGAGCAGACGGTGGGCAACGTGGACGGCTGCGCCATCGCCATGGACCTG
GTCAAGAACAATGCGTCCGAGATGGAGACCAACAACCCGCCCAATGGCCAGAGCAACACGATCCTGAGCCACGAG
GCCGGCCACTTTCTCAGCCTGGAGCACGTCCCGGAGGGCAACGAGGTCAGGCCGGGCGTGCAGAACATCATGGTG
CCCTTTGCCCGTTTCGGCAACAAGTACGCCTTCAACCAAGAGCAGTGCCAGCAGATGAGGGCTGTGGTTCAGAAG
CGGCTCAGTGATAAGAAGGAAATTCCCAAGCAGGGGAACCCCGACCAGATCGCTCAGGGCTTCGGCGGCGGCGGC
GGCGGCGGCAGTGCCAGCAGCAACGGAGGCAGACAGCCGAAACCCACTGGCCCCAGCGGGCCTGGCGGAGGCAGT
CAGCCGGCGCCTTCTGGTCCCAGCGGGCCTGGCGCAGGTGGTGCCGGAGGAGGTCAGTCGGCGCCTGCTGGCCCT
AACGGAGCCGGCGGGGGCGTTGTTGGTGGCGGCGGAGGGCTCGATCCCTTCACGACTGGCGGAGGCGGAGGCGGA
GGATTCCCGTCGACGTCTTACAGTGGTGGTGGCAGCGAAGTGTCGAACGACATAGATTCGTTCAACCCCTTTGGC
TCGGGCAACCCGTTCTAG
Gene >Hirsu2|6168
ATGGTCGTGCCATCATTGTTCGTGGCCAGCTTCATCGCCTCGGCCGTTGTGGTGGCTGGTCCCATCAGCGCGCCC
TCCGGCGACGGAGACATCATAAGCACTTGTTACACACGCGACCGGACGGCAGAGGAGCTGAGACTTTTGCGGCGG
CAACTCACCTTCGGCGGAACCGCCAATGGTTCGCCGTTGGACGACTTGACCGGCAACGGAATCACCCAAGACGCC
TCGCAGTCCGGACAGCAAAGCCCCGGACAAGTTCCCGGACAGCAAAGCCCCGGACAGGTTCCCGGACAGCAAAGC
CCCGGACAAGTTCCGGGACAGGGTCTCGGACAGGGTTCCGGCGGAAGTTCCGGCAACGGGAAAAATGGAGCCTCG
CCGCAGTCTCAGAACGACAGTGGGAACGACTTGGGCGACGGGACAGAAGCACAGAATCCTGGACAGACGCTTCCA
CCCTTGAAGGTCGCCTTCCACTCCTGCTGCACGACGCCTAATGATTGCACCTCGGTAAGTGGATAGATCGGCTCG
CTGCAGCAAGCCGGCCGAGAAAGGACGGGCACTGACGCCGGCGACAGACAGAGGACAGCAAGCACCAGGTGGACG
TACTCAACGAAAACTACCAGCCTTGCGGCATCAGCTGGACGCTGGCCAACGCCACGGCGGTGACCAACGAAAACT
GCGACCGCACCAACCTGGAGAGCGAGAACGAGGTCGACAACTTCAAAATCAGCACCCGCGAGGGCGGCGCCGACA
CGATGAACGTCGTCGTCCTGCCGACCAACGGCGGTCGCGGCGTCAAGGGCAAGTGCTATTCGCCCCCTGCGCCTG
GGCAGGGCCAAGGGTCGATCGAGCAGACGGTGGGCAACGTGGACGGCTGCGCCATCGCCATGGACCTGGTCAAGA
ACAATGCGTCCGAGATGGAGACCAACAACCCGCCCAATGGCCAGAGCAACACGATCCTGAGCCACGAGGCCGGCC
ACTTTCTCAGCCTGGAGCACGTCCCGGAGGGCAACGAGGTCAGGCCGGGCGTGCAGAACATCATGGTGCCCTTTG
CCCGGTACGTGTCCCTCGCCCGCCTTCCGCCGTTTCTCCTTTCTCACGCTAACTGTCGGCCACCAGTTTCGGCAA
CAAGTACGCCTTCAACCAAGAGCAGTGCCAGCAGATGAGGGCTGTGGTTCAGAAGCGGCTCAGTGATAAGAAGGA
AATTCCCAAGCAGGGGAACCCCGACCAGATCGCTCAGGGCTTCGGCGGCGGCGGCGGCGGCGGCAGTGCCAGCAG
CAACGGAGGCAGACAGCCGAAACCCACTGGCCCCAGCGGGCCTGGCGGAGGCAGTCAGCCGGCGCCTTCTGGTCC
CAGCGGGCCTGGCGCAGGTGGTGCCGGAGGAGGTCAGTCGGCGCCTGCTGGCCCTAACGGAGCCGGCGGGGGCGT
TGTTGGTGGCGGCGGAGGGCTCGATCCCTTCACGACTGGCGGAGGCGGAGGCGGAGGATTCCCGTCGACGTCTTA
CAGTGGTGGTGGCAGCGAAGTGTCGAACGACATAGATTCGTTCAACCCCTTTGGCTCGGGCAACCCGTTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail