Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6159
Gene name
LocationContig_3122:142..1117
Strand-
Gene length (bp)975
Transcript length (bp)648
Coding sequence length (bp)648
Protein length (aa) 216

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 7.2E-15 59 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 12 211 5.0E-32
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 19 211 4.0E-30
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 32 211 2.0E-29
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 21 211 3.0E-25
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 36 213 8.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 12 211 5.0E-32
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 19 211 4.0E-30
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 32 211 2.0E-29
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 21 211 3.0E-25
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 36 213 8.0E-22
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 31 169 2.0E-20
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 36 169 2.0E-20
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 4 191 3.0E-18
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 9 211 3.0E-18
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 38 213 2.0E-16
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 41 213 7.0E-16
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 41 181 1.0E-15
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 2 200 2.0E-14
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 28 197 2.0E-13
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 37 211 5.0E-13
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 25 173 7.0E-12
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 44 183 7.0E-12
sp|P53241|VHT1_YEAST Vitamin H transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VHT1 PE=1 SV=1 38 213 9.0E-09
sp|O13880|VHT1_SCHPO Vitamin H transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vht1 PE=2 SV=1 1 182 1.0E-08
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 26 177 5.0E-08
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 34 182 6.0E-08
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 39 169 7.0E-08
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 32 186 5.0E-07
sp|Q12235|YCT1_YEAST High affinity cysteine transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCT1 PE=1 SV=1 35 173 5.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0022857 transmembrane transporter activity Yes
GO:0009987 cellular process No
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0008150 biological_process No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 52 69 17
2 89 111 22
3 118 137 19
4 143 165 22
5 178 200 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6159
MEDRRPSSEAEKQADVVAVATDRPGSGSADDDGVSLTAEEERRVMRRVDRRLVVTVGALYCVSLMDRTNMSAANI
AGMSTELRLQGFRYNIANLVFFIPYILFQPPSTVLVRKIGPRLHLAGIILCWGAVMIGMGFVRDFAQLAGLRAVL
GLLEAGFFPSCVYLLSTWYTRYEVGKRYSVFYLLGCVASACSGILASAAGPASAAGGGSSWWRAR*
Coding >Hirsu2|6159
ATGGAGGACCGCCGCCCCAGCTCCGAGGCCGAGAAGCAGGCGGACGTGGTGGCCGTGGCCACGGACCGGCCCGGC
TCGGGCTCGGCCGACGACGACGGCGTGAGCCTGACGGCCGAGGAGGAGCGGCGCGTGATGCGGCGCGTCGACCGC
CGGCTCGTCGTCACCGTCGGCGCCCTCTACTGCGTCAGCCTCATGGACCGCACCAACATGAGCGCGGCCAACATC
GCGGGCATGAGCACCGAGCTGCGCCTCCAGGGCTTCCGTTACAACATCGCCAACCTCGTCTTCTTCATCCCGTAC
ATCCTGTTCCAGCCGCCGTCGACGGTGCTGGTGCGCAAGATCGGCCCGCGGCTGCACCTGGCCGGCATCATCCTG
TGCTGGGGCGCCGTCATGATCGGCATGGGCTTCGTGCGCGACTTCGCCCAGCTGGCGGGCCTGCGCGCCGTGCTG
GGCCTCCTCGAGGCCGGCTTCTTCCCCAGCTGCGTCTACCTGCTCAGCACCTGGTACACGCGATACGAGGTCGGC
AAGCGGTACTCGGTCTTCTACCTGCTCGGCTGCGTCGCCTCGGCCTGCTCCGGCATCCTGGCCTCGGCGGCCGGG
CCGGCCTCGGCGGCTGGCGGTGGATCTTCGTGGTGGAGGGCGCGCTGA
Transcript >Hirsu2|6159
ATGGAGGACCGCCGCCCCAGCTCCGAGGCCGAGAAGCAGGCGGACGTGGTGGCCGTGGCCACGGACCGGCCCGGC
TCGGGCTCGGCCGACGACGACGGCGTGAGCCTGACGGCCGAGGAGGAGCGGCGCGTGATGCGGCGCGTCGACCGC
CGGCTCGTCGTCACCGTCGGCGCCCTCTACTGCGTCAGCCTCATGGACCGCACCAACATGAGCGCGGCCAACATC
GCGGGCATGAGCACCGAGCTGCGCCTCCAGGGCTTCCGTTACAACATCGCCAACCTCGTCTTCTTCATCCCGTAC
ATCCTGTTCCAGCCGCCGTCGACGGTGCTGGTGCGCAAGATCGGCCCGCGGCTGCACCTGGCCGGCATCATCCTG
TGCTGGGGCGCCGTCATGATCGGCATGGGCTTCGTGCGCGACTTCGCCCAGCTGGCGGGCCTGCGCGCCGTGCTG
GGCCTCCTCGAGGCCGGCTTCTTCCCCAGCTGCGTCTACCTGCTCAGCACCTGGTACACGCGATACGAGGTCGGC
AAGCGGTACTCGGTCTTCTACCTGCTCGGCTGCGTCGCCTCGGCCTGCTCCGGCATCCTGGCCTCGGCGGCCGGG
CCGGCCTCGGCGGCTGGCGGTGGATCTTCGTGGTGGAGGGCGCGCTGA
Gene >Hirsu2|6159
ATGGAGGACCGCCGCCCCAGCTCCGAGGCCGAGAAGCAGGCGGACGTGGTGGCCGTGGCCACGGACCGGCCCGGC
TCGGGCTCGGCCGACGACGACGGCGTGAGCCTGACGGCCGAGGAGGAGCGGCGCGTGATGCGGCGCGTCGACCGC
CGGCTCGTCGTCACCGTCGGCGCCCTCTACTGCGTCAGCCTCATGGACCGCACCAACATGAGCGCGGCCAACATC
GCGGGCATGAGCACCGAGCTGCGCCTCCAGGGCTTCCGTTACGTGCGTCGCCTTCCATTCTGGGCTCCGCCGCCT
CGTGGCTGACTGCTGCGTGGAGGGCAGAACATCGCCAACCTCGTCTTCTTCATCCCGTACATCCTGTTCCAGCCG
CCGTCGACGGTGCTGGTGCGCAAGATCGGCCCGCGGCTGCACCTGGCCGGCATCATCCTGTGCTGGGGCGCCGTC
ATGATCGGCATGGGCTTCGTGCGCGACTTCGCCCAGCTGGCGGGCCTGCGCGCCGTGCTGGGCCTCCTCGAGGCC
GGCTTCTTCCCCAGCTGCGTCTACCTGCTCAGCACCTGGTACACGCGATGTGGGTAGCTTCTTCTTCCTCTTCTT
CTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTCTCCTTCTCCTTCTCCTTTTTATTTTTTTTGGCCC
CCTTCTTGGCCGCGAGCCGCGTGCGAGAGGATGAGGGATGCTGACGGGATTGGGCGCGGGCGTCGTGGGGGGAGA
AGACGAGGTCGGCAAGCGGTACTCGGTCTTCTACCTGCTCGGCTGCGTCGCCTCGGCCTGCTCCGGCATCCTGGC
GTACGGGGTAGGTTGGAGCCCCGGCCCCCGGCCCGATGACCCGCTTTCTGACCGGCGGCGGCGCCGAACAACGAC
AACAGCTGATGCAGCTCGGCGGCCGGGCCGGCCTCGGCGGCTGGCGGTGGATCTTCGTGGTGGAGGGCGCGCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail