Fungal Genomics

at Utrecht University

General Properties

Protein IDHirsu2|6156
Gene name
LocationContig_312:18433..19732
Strand-
Gene length (bp)1299
Transcript length (bp)1299
Coding sequence length (bp)1299
Protein length (aa) 433

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09468 RNase_H2-Ydr279 Ydr279p protein family (RNase H2 complex component) wHTH domain 3.4E-47 130 339
PF17745 Ydr279_N Ydr279p protein triple barrel domain 4.4E-22 40 127

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94627|RNH2B_SCHPO Ribonuclease H2 subunit B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnh202 PE=3 SV=1 37 241 7.0E-08

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3822 0.896 0.088 0.0237 0.0955 0.0099 0.0421 0.0127 0.0223 0.0064

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3329
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6458
Ophiocordyceps australis map64 (Brazil) OphauB2|2554
Ophiocordyceps camponoti-floridani Ophcf2|01465
Ophiocordyceps camponoti-rufipedis Ophun1|2713
Ophiocordyceps kimflemingae Ophio5|3839
Ophiocordyceps subramaniannii Hirsu2|6156 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Hirsu2|6156
MARTRSTKANPADSKAPPTPSACSKITLSASTGPPPRLFVLPKSATAEARIVLLPNPRHGRPARYLVCPESGMYE
FIKVAAPKSAPKSWLIETRGELSGEEIPSGDATQMGAQVVMDADMFMATHIDPLFLVLPALADDKASKESDEKRR
LFLSSDDWLDKLPQESSHLCEILRWPHTRALIEKRMAAVCDSVEAGDEAMFRLSEDKLLKAIFDKAKKLSEGGLP
PSMEDKFVKRVLETPVLLSKRDAEGSLTANEKAASPTASAQTEPTDSQSTAAPNGVASTSPSQTATLPTEDKADD
GFASSTETPPGVLNLQRLRVAFDFICSSYLSPHLAERLQRALKASSYADFAPLDEYLATVARLRAEAVELSSFAD
FSRKRSRDEEDDEARAEKKRALEDEKKRKANQSRGVRELKKVNTSGMMKLSAFFKSK*
Coding >Hirsu2|6156
ATGGCGCGGACGAGGTCGACCAAGGCCAATCCGGCCGACTCGAAAGCGCCCCCGACGCCGAGTGCTTGCTCCAAG
ATAACATTGAGTGCCAGCACCGGCCCGCCGCCCAGGCTATTCGTCCTGCCGAAAAGCGCGACTGCCGAGGCTCGC
ATTGTCCTACTGCCCAACCCCAGGCACGGCCGGCCGGCGCGCTACCTCGTTTGCCCGGAATCGGGCATGTACGAG
TTCATCAAAGTCGCCGCCCCCAAGTCGGCGCCGAAAAGCTGGCTGATCGAGACCCGCGGCGAGTTGTCTGGCGAG
GAAATACCAAGCGGCGACGCGACCCAGATGGGCGCGCAAGTCGTCATGGACGCCGACATGTTCATGGCGACGCAT
ATCGATCCACTGTTCCTCGTCCTGCCAGCCCTGGCAGACGACAAAGCCTCGAAGGAGTCGGACGAGAAGAGACGC
CTCTTCCTGTCGAGCGACGATTGGCTCGACAAGCTCCCGCAAGAGTCGTCCCACCTGTGCGAGATACTTCGGTGG
CCTCACACGCGTGCTCTCATCGAGAAAAGAATGGCAGCCGTCTGCGATTCCGTCGAGGCCGGCGACGAGGCCATG
TTCCGCCTGAGCGAGGACAAGCTGCTGAAGGCAATCTTCGACAAGGCCAAGAAGCTGAGCGAGGGAGGTCTCCCT
CCCAGTATGGAGGACAAGTTCGTCAAGAGAGTGTTGGAGACACCGGTCCTGCTGTCCAAGCGCGACGCCGAGGGC
AGCCTGACCGCCAACGAGAAAGCCGCTTCTCCGACGGCGTCGGCGCAGACCGAGCCCACCGACTCCCAATCCACA
GCTGCCCCGAACGGCGTCGCGTCGACATCGCCCTCCCAGACGGCGACGCTTCCGACCGAGGACAAGGCCGACGAT
GGCTTTGCGTCCAGTACCGAAACGCCGCCGGGCGTTCTCAACCTGCAGCGGCTGCGGGTCGCCTTCGACTTCATC
TGTTCGAGCTACCTATCGCCACATCTGGCTGAGCGCCTGCAGCGAGCCCTGAAAGCTTCCAGCTACGCCGACTTC
GCCCCCCTGGACGAGTACCTGGCCACGGTTGCGCGGCTGCGGGCGGAGGCTGTAGAGCTGAGCTCATTCGCCGAT
TTCTCTCGGAAGCGCTCTCGCGATGAGGAGGATGACGAGGCCCGCGCGGAAAAGAAACGGGCGTTGGAGGATGAG
AAGAAGCGCAAGGCGAATCAGAGCCGCGGAGTCAGGGAGCTCAAAAAGGTCAACACCAGCGGCATGATGAAGCTG
AGCGCCTTTTTCAAGTCCAAATGA
Transcript >Hirsu2|6156
ATGGCGCGGACGAGGTCGACCAAGGCCAATCCGGCCGACTCGAAAGCGCCCCCGACGCCGAGTGCTTGCTCCAAG
ATAACATTGAGTGCCAGCACCGGCCCGCCGCCCAGGCTATTCGTCCTGCCGAAAAGCGCGACTGCCGAGGCTCGC
ATTGTCCTACTGCCCAACCCCAGGCACGGCCGGCCGGCGCGCTACCTCGTTTGCCCGGAATCGGGCATGTACGAG
TTCATCAAAGTCGCCGCCCCCAAGTCGGCGCCGAAAAGCTGGCTGATCGAGACCCGCGGCGAGTTGTCTGGCGAG
GAAATACCAAGCGGCGACGCGACCCAGATGGGCGCGCAAGTCGTCATGGACGCCGACATGTTCATGGCGACGCAT
ATCGATCCACTGTTCCTCGTCCTGCCAGCCCTGGCAGACGACAAAGCCTCGAAGGAGTCGGACGAGAAGAGACGC
CTCTTCCTGTCGAGCGACGATTGGCTCGACAAGCTCCCGCAAGAGTCGTCCCACCTGTGCGAGATACTTCGGTGG
CCTCACACGCGTGCTCTCATCGAGAAAAGAATGGCAGCCGTCTGCGATTCCGTCGAGGCCGGCGACGAGGCCATG
TTCCGCCTGAGCGAGGACAAGCTGCTGAAGGCAATCTTCGACAAGGCCAAGAAGCTGAGCGAGGGAGGTCTCCCT
CCCAGTATGGAGGACAAGTTCGTCAAGAGAGTGTTGGAGACACCGGTCCTGCTGTCCAAGCGCGACGCCGAGGGC
AGCCTGACCGCCAACGAGAAAGCCGCTTCTCCGACGGCGTCGGCGCAGACCGAGCCCACCGACTCCCAATCCACA
GCTGCCCCGAACGGCGTCGCGTCGACATCGCCCTCCCAGACGGCGACGCTTCCGACCGAGGACAAGGCCGACGAT
GGCTTTGCGTCCAGTACCGAAACGCCGCCGGGCGTTCTCAACCTGCAGCGGCTGCGGGTCGCCTTCGACTTCATC
TGTTCGAGCTACCTATCGCCACATCTGGCTGAGCGCCTGCAGCGAGCCCTGAAAGCTTCCAGCTACGCCGACTTC
GCCCCCCTGGACGAGTACCTGGCCACGGTTGCGCGGCTGCGGGCGGAGGCTGTAGAGCTGAGCTCATTCGCCGAT
TTCTCTCGGAAGCGCTCTCGCGATGAGGAGGATGACGAGGCCCGCGCGGAAAAGAAACGGGCGTTGGAGGATGAG
AAGAAGCGCAAGGCGAATCAGAGCCGCGGAGTCAGGGAGCTCAAAAAGGTCAACACCAGCGGCATGATGAAGCTG
AGCGCCTTTTTCAAGTCCAAATGA
Gene >Hirsu2|6156
ATGGCGCGGACGAGGTCGACCAAGGCCAATCCGGCCGACTCGAAAGCGCCCCCGACGCCGAGTGCTTGCTCCAAG
ATAACATTGAGTGCCAGCACCGGCCCGCCGCCCAGGCTATTCGTCCTGCCGAAAAGCGCGACTGCCGAGGCTCGC
ATTGTCCTACTGCCCAACCCCAGGCACGGCCGGCCGGCGCGCTACCTCGTTTGCCCGGAATCGGGCATGTACGAG
TTCATCAAAGTCGCCGCCCCCAAGTCGGCGCCGAAAAGCTGGCTGATCGAGACCCGCGGCGAGTTGTCTGGCGAG
GAAATACCAAGCGGCGACGCGACCCAGATGGGCGCGCAAGTCGTCATGGACGCCGACATGTTCATGGCGACGCAT
ATCGATCCACTGTTCCTCGTCCTGCCAGCCCTGGCAGACGACAAAGCCTCGAAGGAGTCGGACGAGAAGAGACGC
CTCTTCCTGTCGAGCGACGATTGGCTCGACAAGCTCCCGCAAGAGTCGTCCCACCTGTGCGAGATACTTCGGTGG
CCTCACACGCGTGCTCTCATCGAGAAAAGAATGGCAGCCGTCTGCGATTCCGTCGAGGCCGGCGACGAGGCCATG
TTCCGCCTGAGCGAGGACAAGCTGCTGAAGGCAATCTTCGACAAGGCCAAGAAGCTGAGCGAGGGAGGTCTCCCT
CCCAGTATGGAGGACAAGTTCGTCAAGAGAGTGTTGGAGACACCGGTCCTGCTGTCCAAGCGCGACGCCGAGGGC
AGCCTGACCGCCAACGAGAAAGCCGCTTCTCCGACGGCGTCGGCGCAGACCGAGCCCACCGACTCCCAATCCACA
GCTGCCCCGAACGGCGTCGCGTCGACATCGCCCTCCCAGACGGCGACGCTTCCGACCGAGGACAAGGCCGACGAT
GGCTTTGCGTCCAGTACCGAAACGCCGCCGGGCGTTCTCAACCTGCAGCGGCTGCGGGTCGCCTTCGACTTCATC
TGTTCGAGCTACCTATCGCCACATCTGGCTGAGCGCCTGCAGCGAGCCCTGAAAGCTTCCAGCTACGCCGACTTC
GCCCCCCTGGACGAGTACCTGGCCACGGTTGCGCGGCTGCGGGCGGAGGCTGTAGAGCTGAGCTCATTCGCCGAT
TTCTCTCGGAAGCGCTCTCGCGATGAGGAGGATGACGAGGCCCGCGCGGAAAAGAAACGGGCGTTGGAGGATGAG
AAGAAGCGCAAGGCGAATCAGAGCCGCGGAGTCAGGGAGCTCAAAAAGGTCAACACCAGCGGCATGATGAAGCTG
AGCGCCTTTTTCAAGTCCAAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail